FuNGI

A0A166IFD6

Protein Details

Accession

A0A166IFD6

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
1-22	MGGGPAKAPRPRPRLRNQILGG	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

mito 11, plas 8, E.R. 4, cyto 2, extr 2

Family & Domain DBs

InterPro	View protein in InterPro IPR002056 MAS20 IPR001915 Peptidase_M48 IPR023392 Tom20_dom_sf
Gene Ontology	GO:0005742 C:mitochondrial outer membrane translocase complex GO:0046872 F:metal ion binding GO:0004222 F:metalloendopeptidase activity GO:0006605 P:protein targeting GO:0006508 P:proteolysis
Pfam	View protein in Pfam PF02064 MAS20 PF01435 Peptidase_M48
CDD	cd07331 M48C_Oma1_like

Amino Acid Sequences

MGGGPAKAPRPRPRLRNQILGGLAGAAGLYYVTHLERVPETGRLRFMDVSPKFEEMLWSESYGSMMNEYRGKILPPNHPLARRVHAVASRILEANNLGTLHAVGANESMSTRSIMFGRQRDAEAWDVPSSPDNVKGGLAHKEWHLIVVNDPKMVNAAAAPGSIVVFTGILPVVQDDEHLAAVLGHEVAHVVLRHSAESMSSMRIAFLFAFAIDILIADQVGLRLSSNACFDPKAAPEVFERLGELERKMGMSGMDILRTHPASDKRVQALNARVQEGYSILSANPSCSETRSQFTSFKDFFRSSAPTPEHAPPALVPAMGGSFPDVPSEHQARQASRSSMPPLPSSVSELDLQFVVRQIKMERPPSDDSQREIYITEAIKKGEALFTDPSPLPAAVYLYRALRAHPNPSRVLEAYRNRVPEPVFAVVARLVEMVGFI

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.81
2	0.82
3	0.84
4	0.76
5	0.74
6	0.66
7	0.57
8	0.47
9	0.35
10	0.28
11	0.17
12	0.14
13	0.06
14	0.04
15	0.03
16	0.03
17	0.03
18	0.05
19	0.05
20	0.07
21	0.08
22	0.11
23	0.12
24	0.16
25	0.17
26	0.23
27	0.27
28	0.29
29	0.33
30	0.32
31	0.35
32	0.33
33	0.33
34	0.36
35	0.34
36	0.36
37	0.35
38	0.35
39	0.32
40	0.3
41	0.31
42	0.23
43	0.25
44	0.21
45	0.19
46	0.18
47	0.17
48	0.18
49	0.16
50	0.13
51	0.12
52	0.12
53	0.14
54	0.17
55	0.17
56	0.2
57	0.2
58	0.21
59	0.24
60	0.3
61	0.35
62	0.38
63	0.45
64	0.48
65	0.51
66	0.53
67	0.53
68	0.51
69	0.46
70	0.42
71	0.39
72	0.37
73	0.36
74	0.36
75	0.33
76	0.29
77	0.27
78	0.24
79	0.2
80	0.17
81	0.15
82	0.13
83	0.11
84	0.09
85	0.08
86	0.08
87	0.08
88	0.09
89	0.08
90	0.06
91	0.07
92	0.07
93	0.07
94	0.07
95	0.07
96	0.06
97	0.07
98	0.07
99	0.08
100	0.09
101	0.14
102	0.2
103	0.23
104	0.26
105	0.27
106	0.28
107	0.28
108	0.3
109	0.28
110	0.24
111	0.22
112	0.19
113	0.18
114	0.17
115	0.17
116	0.17
117	0.14
118	0.16
119	0.14
120	0.14
121	0.14
122	0.15
123	0.16
124	0.19
125	0.19
126	0.17
127	0.18
128	0.2
129	0.19
130	0.19
131	0.18
132	0.13
133	0.16
134	0.23
135	0.23
136	0.21
137	0.21
138	0.19
139	0.19
140	0.18
141	0.14
142	0.07
143	0.07
144	0.06
145	0.06
146	0.06
147	0.05
148	0.05
149	0.05
150	0.05
151	0.03
152	0.03
153	0.03
154	0.04
155	0.04
156	0.04
157	0.04
158	0.04
159	0.04
160	0.04
161	0.04
162	0.04
163	0.05
164	0.05
165	0.05
166	0.05
167	0.04
168	0.04
169	0.05
170	0.04
171	0.03
172	0.03
173	0.03
174	0.03
175	0.04
176	0.05
177	0.05
178	0.07
179	0.07
180	0.08
181	0.08
182	0.08
183	0.07
184	0.09
185	0.1
186	0.08
187	0.09
188	0.09
189	0.08
190	0.08
191	0.09
192	0.07
193	0.06
194	0.05
195	0.04
196	0.04
197	0.04
198	0.04
199	0.03
200	0.03
201	0.03
202	0.03
203	0.03
204	0.02
205	0.02
206	0.02
207	0.03
208	0.03
209	0.03
210	0.04
211	0.04
212	0.06
213	0.07
214	0.08
215	0.08
216	0.09
217	0.09
218	0.11
219	0.11
220	0.14
221	0.13
222	0.13
223	0.14
224	0.17
225	0.17
226	0.14
227	0.14
228	0.11
229	0.13
230	0.13
231	0.12
232	0.1
233	0.1
234	0.1
235	0.1
236	0.09
237	0.07
238	0.07
239	0.1
240	0.09
241	0.1
242	0.1
243	0.11
244	0.13
245	0.13
246	0.13
247	0.14
248	0.18
249	0.21
250	0.25
251	0.29
252	0.29
253	0.32
254	0.33
255	0.33
256	0.36
257	0.37
258	0.35
259	0.33
260	0.29
261	0.26
262	0.25
263	0.21
264	0.16
265	0.1
266	0.08
267	0.06
268	0.09
269	0.09
270	0.09
271	0.1
272	0.11
273	0.11
274	0.12
275	0.16
276	0.17
277	0.2
278	0.23
279	0.26
280	0.28
281	0.3
282	0.37
283	0.35
284	0.34
285	0.37
286	0.33
287	0.31
288	0.31
289	0.33
290	0.27
291	0.33
292	0.34
293	0.3
294	0.34
295	0.36
296	0.34
297	0.29
298	0.28
299	0.2
300	0.21
301	0.2
302	0.15
303	0.12
304	0.09
305	0.1
306	0.09
307	0.09
308	0.07
309	0.07
310	0.07
311	0.09
312	0.09
313	0.1
314	0.16
315	0.21
316	0.2
317	0.26
318	0.29
319	0.3
320	0.34
321	0.37
322	0.35
323	0.33
324	0.36
325	0.35
326	0.36
327	0.36
328	0.33
329	0.3
330	0.29
331	0.28
332	0.28
333	0.24
334	0.22
335	0.21
336	0.2
337	0.18
338	0.16
339	0.15
340	0.12
341	0.14
342	0.14
343	0.13
344	0.15
345	0.16
346	0.24
347	0.31
348	0.39
349	0.38
350	0.41
351	0.47
352	0.51
353	0.58
354	0.53
355	0.49
356	0.47
357	0.45
358	0.4
359	0.35
360	0.3
361	0.26
362	0.25
363	0.26
364	0.23
365	0.22
366	0.22
367	0.22
368	0.22
369	0.19
370	0.18
371	0.17
372	0.18
373	0.18
374	0.23
375	0.23
376	0.23
377	0.23
378	0.22
379	0.18
380	0.16
381	0.18
382	0.14
383	0.16
384	0.17
385	0.16
386	0.2
387	0.2
388	0.21
389	0.27
390	0.3
391	0.38
392	0.43
393	0.47
394	0.48
395	0.51
396	0.54
397	0.47
398	0.49
399	0.48
400	0.5
401	0.52
402	0.54
403	0.55
404	0.5
405	0.52
406	0.48
407	0.43
408	0.4
409	0.36
410	0.32
411	0.28
412	0.29
413	0.25
414	0.24
415	0.2
416	0.14
417	0.1

A0A166IFD6

3D AlphaFold-predicted Structure Viewer