Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166IFD6

Protein Details
Accession A0A166IFD6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MGGGPAKAPRPRPRLRNQILGGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, plas 8, E.R. 4, cyto 2, extr 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR002056  MAS20  
IPR001915  Peptidase_M48  
IPR023392  Tom20_dom_sf  
Gene Ontology GO:0005742  C:mitochondrial outer membrane translocase complex  
GO:0046872  F:metal ion binding  
GO:0004222  F:metalloendopeptidase activity  
GO:0006605  P:protein targeting  
GO:0006508  P:proteolysis  
Pfam View protein in Pfam  
PF02064  MAS20  
PF01435  Peptidase_M48  
CDD cd07331  M48C_Oma1_like  
Amino Acid Sequences MGGGPAKAPRPRPRLRNQILGGLAGAAGLYYVTHLERVPETGRLRFMDVSPKFEEMLWSESYGSMMNEYRGKILPPNHPLARRVHAVASRILEANNLGTLHAVGANESMSTRSIMFGRQRDAEAWDVPSSPDNVKGGLAHKEWHLIVVNDPKMVNAAAAPGSIVVFTGILPVVQDDEHLAAVLGHEVAHVVLRHSAESMSSMRIAFLFAFAIDILIADQVGLRLSSNACFDPKAAPEVFERLGELERKMGMSGMDILRTHPASDKRVQALNARVQEGYSILSANPSCSETRSQFTSFKDFFRSSAPTPEHAPPALVPAMGGSFPDVPSEHQARQASRSSMPPLPSSVSELDLQFVVRQIKMERPPSDDSQREIYITEAIKKGEALFTDPSPLPAAVYLYRALRAHPNPSRVLEAYRNRVPEPVFAVVARLVEMVGFI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.82
3 0.84
4 0.76
5 0.74
6 0.66
7 0.57
8 0.47
9 0.35
10 0.28
11 0.17
12 0.14
13 0.06
14 0.04
15 0.03
16 0.03
17 0.03
18 0.05
19 0.05
20 0.07
21 0.08
22 0.11
23 0.12
24 0.16
25 0.17
26 0.23
27 0.27
28 0.29
29 0.33
30 0.32
31 0.35
32 0.33
33 0.33
34 0.36
35 0.34
36 0.36
37 0.35
38 0.35
39 0.32
40 0.3
41 0.31
42 0.23
43 0.25
44 0.21
45 0.19
46 0.18
47 0.17
48 0.18
49 0.16
50 0.13
51 0.12
52 0.12
53 0.14
54 0.17
55 0.17
56 0.2
57 0.2
58 0.21
59 0.24
60 0.3
61 0.35
62 0.38
63 0.45
64 0.48
65 0.51
66 0.53
67 0.53
68 0.51
69 0.46
70 0.42
71 0.39
72 0.37
73 0.36
74 0.36
75 0.33
76 0.29
77 0.27
78 0.24
79 0.2
80 0.17
81 0.15
82 0.13
83 0.11
84 0.09
85 0.08
86 0.08
87 0.08
88 0.09
89 0.08
90 0.06
91 0.07
92 0.07
93 0.07
94 0.07
95 0.07
96 0.06
97 0.07
98 0.07
99 0.08
100 0.09
101 0.14
102 0.2
103 0.23
104 0.26
105 0.27
106 0.28
107 0.28
108 0.3
109 0.28
110 0.24
111 0.22
112 0.19
113 0.18
114 0.17
115 0.17
116 0.17
117 0.14
118 0.16
119 0.14
120 0.14
121 0.14
122 0.15
123 0.16
124 0.19
125 0.19
126 0.17
127 0.18
128 0.2
129 0.19
130 0.19
131 0.18
132 0.13
133 0.16
134 0.23
135 0.23
136 0.21
137 0.21
138 0.19
139 0.19
140 0.18
141 0.14
142 0.07
143 0.07
144 0.06
145 0.06
146 0.06
147 0.05
148 0.05
149 0.05
150 0.05
151 0.03
152 0.03
153 0.03
154 0.04
155 0.04
156 0.04
157 0.04
158 0.04
159 0.04
160 0.04
161 0.04
162 0.04
163 0.05
164 0.05
165 0.05
166 0.05
167 0.04
168 0.04
169 0.05
170 0.04
171 0.03
172 0.03
173 0.03
174 0.03
175 0.04
176 0.05
177 0.05
178 0.07
179 0.07
180 0.08
181 0.08
182 0.08
183 0.07
184 0.09
185 0.1
186 0.08
187 0.09
188 0.09
189 0.08
190 0.08
191 0.09
192 0.07
193 0.06
194 0.05
195 0.04
196 0.04
197 0.04
198 0.04
199 0.03
200 0.03
201 0.03
202 0.03
203 0.03
204 0.02
205 0.02
206 0.02
207 0.03
208 0.03
209 0.03
210 0.04
211 0.04
212 0.06
213 0.07
214 0.08
215 0.08
216 0.09
217 0.09
218 0.11
219 0.11
220 0.14
221 0.13
222 0.13
223 0.14
224 0.17
225 0.17
226 0.14
227 0.14
228 0.11
229 0.13
230 0.13
231 0.12
232 0.1
233 0.1
234 0.1
235 0.1
236 0.09
237 0.07
238 0.07
239 0.1
240 0.09
241 0.1
242 0.1
243 0.11
244 0.13
245 0.13
246 0.13
247 0.14
248 0.18
249 0.21
250 0.25
251 0.29
252 0.29
253 0.32
254 0.33
255 0.33
256 0.36
257 0.37
258 0.35
259 0.33
260 0.29
261 0.26
262 0.25
263 0.21
264 0.16
265 0.1
266 0.08
267 0.06
268 0.09
269 0.09
270 0.09
271 0.1
272 0.11
273 0.11
274 0.12
275 0.16
276 0.17
277 0.2
278 0.23
279 0.26
280 0.28
281 0.3
282 0.37
283 0.35
284 0.34
285 0.37
286 0.33
287 0.31
288 0.31
289 0.33
290 0.27
291 0.33
292 0.34
293 0.3
294 0.34
295 0.36
296 0.34
297 0.29
298 0.28
299 0.2
300 0.21
301 0.2
302 0.15
303 0.12
304 0.09
305 0.1
306 0.09
307 0.09
308 0.07
309 0.07
310 0.07
311 0.09
312 0.09
313 0.1
314 0.16
315 0.21
316 0.2
317 0.26
318 0.29
319 0.3
320 0.34
321 0.37
322 0.35
323 0.33
324 0.36
325 0.35
326 0.36
327 0.36
328 0.33
329 0.3
330 0.29
331 0.28
332 0.28
333 0.24
334 0.22
335 0.21
336 0.2
337 0.18
338 0.16
339 0.15
340 0.12
341 0.14
342 0.14
343 0.13
344 0.15
345 0.16
346 0.24
347 0.31
348 0.39
349 0.38
350 0.41
351 0.47
352 0.51
353 0.58
354 0.53
355 0.49
356 0.47
357 0.45
358 0.4
359 0.35
360 0.3
361 0.26
362 0.25
363 0.26
364 0.23
365 0.22
366 0.22
367 0.22
368 0.22
369 0.19
370 0.18
371 0.17
372 0.18
373 0.18
374 0.23
375 0.23
376 0.23
377 0.23
378 0.22
379 0.18
380 0.16
381 0.18
382 0.14
383 0.16
384 0.17
385 0.16
386 0.2
387 0.2
388 0.21
389 0.27
390 0.3
391 0.38
392 0.43
393 0.47
394 0.48
395 0.51
396 0.54
397 0.47
398 0.49
399 0.48
400 0.5
401 0.52
402 0.54
403 0.55
404 0.5
405 0.52
406 0.48
407 0.43
408 0.4
409 0.36
410 0.32
411 0.28
412 0.29
413 0.25
414 0.24
415 0.2
416 0.14
417 0.1