Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166FS76

Protein Details
Accession A0A166FS76    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
132-159RSRVLTRHVGMPKRRRRCARREVWCLESHydrophilic
NLS Segment(s)
PositionSequence
75-117SRKRKGAGVGTRAERGERRAEGTRIHMRLQLRVLRGRWPGGRR
142-148MPKRRRR
Subcellular Location(s) mito 20, nucl 4, cyto 2
Family & Domain DBs
Amino Acid Sequences MLNVNLSHAPTAISGACRTRIGKHALPAPASECVAAARTTHAGTPGLILYPPRARPLAQDESERDEGLKRSLRCSRKRKGAGVGTRAERGERRAEGTRIHMRLQLRVLRGRWPGGRRPQCAPPPGRCPQHARSRVLTRHVGMPKRRRRCARREVWCLES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.17
3 0.19
4 0.21
5 0.23
6 0.24
7 0.29
8 0.35
9 0.36
10 0.39
11 0.43
12 0.44
13 0.43
14 0.41
15 0.37
16 0.31
17 0.28
18 0.22
19 0.16
20 0.13
21 0.13
22 0.12
23 0.1
24 0.1
25 0.11
26 0.11
27 0.12
28 0.12
29 0.12
30 0.11
31 0.12
32 0.1
33 0.09
34 0.09
35 0.09
36 0.11
37 0.15
38 0.16
39 0.17
40 0.18
41 0.17
42 0.2
43 0.28
44 0.32
45 0.29
46 0.32
47 0.31
48 0.36
49 0.37
50 0.34
51 0.26
52 0.21
53 0.2
54 0.21
55 0.24
56 0.18
57 0.22
58 0.31
59 0.39
60 0.47
61 0.54
62 0.58
63 0.63
64 0.68
65 0.67
66 0.66
67 0.66
68 0.63
69 0.59
70 0.55
71 0.47
72 0.43
73 0.39
74 0.33
75 0.26
76 0.22
77 0.21
78 0.17
79 0.2
80 0.22
81 0.23
82 0.24
83 0.3
84 0.34
85 0.32
86 0.33
87 0.32
88 0.29
89 0.31
90 0.34
91 0.32
92 0.28
93 0.31
94 0.31
95 0.34
96 0.35
97 0.37
98 0.38
99 0.38
100 0.43
101 0.49
102 0.56
103 0.54
104 0.56
105 0.6
106 0.61
107 0.65
108 0.62
109 0.59
110 0.58
111 0.63
112 0.63
113 0.59
114 0.6
115 0.6
116 0.65
117 0.65
118 0.62
119 0.62
120 0.66
121 0.67
122 0.66
123 0.63
124 0.54
125 0.56
126 0.58
127 0.58
128 0.59
129 0.64
130 0.68
131 0.73
132 0.81
133 0.83
134 0.85
135 0.87
136 0.89
137 0.89
138 0.89
139 0.89