Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165XGD5

Protein Details
Accession A0A165XGD5    Localization Confidence High Confidence Score 16.7
NoLS Segment(s)
PositionSequenceProtein Nature
2-26FSASSSTYRPLKRRRRTATSVMAGDHydrophilic
69-92ATPEVAKKKRGRPPKVRPKAPDAABasic
186-211MPSSMPQPPKERKPRQSARKGWKGWVHydrophilic
NLS Segment(s)
PositionSequence
74-88AKKKRGRPPKVRPKA
195-206KERKPRQSARKG
Subcellular Location(s) mito 18.5, mito_nucl 13.666, nucl 7.5, cyto_nucl 5.333
Family & Domain DBs
Amino Acid Sequences MFSASSSTYRPLKRRRRTATSVMAGDFDAKPRRDVLTSVLNGVPPNPEAENRGWEEKKRPERVVLDVVATPEVAKKKRGRPPKVRPKAPDAADATPTAAVNAANPAPVANPVISTPTPVRPLAGTPFDTSAFGSRTVIHMLSQNRARSLTPPPMPSSPPTTPGPSISSSTSQVSSKRLRTPDDLDMPSSMPQPPKERKPRQSARKGWKGWVEISDDEEDTSKRIKLDDPVPVLKEKRLRSGREL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.83
3 0.84
4 0.85
5 0.86
6 0.85
7 0.82
8 0.74
9 0.64
10 0.55
11 0.46
12 0.41
13 0.32
14 0.27
15 0.27
16 0.24
17 0.25
18 0.26
19 0.29
20 0.27
21 0.28
22 0.27
23 0.29
24 0.29
25 0.31
26 0.3
27 0.28
28 0.27
29 0.26
30 0.23
31 0.13
32 0.15
33 0.13
34 0.13
35 0.16
36 0.18
37 0.23
38 0.24
39 0.32
40 0.32
41 0.34
42 0.41
43 0.48
44 0.56
45 0.58
46 0.57
47 0.56
48 0.57
49 0.58
50 0.56
51 0.47
52 0.39
53 0.32
54 0.3
55 0.24
56 0.2
57 0.15
58 0.12
59 0.17
60 0.16
61 0.22
62 0.28
63 0.37
64 0.46
65 0.57
66 0.64
67 0.69
68 0.79
69 0.84
70 0.88
71 0.87
72 0.83
73 0.8
74 0.78
75 0.69
76 0.65
77 0.57
78 0.48
79 0.42
80 0.37
81 0.3
82 0.22
83 0.2
84 0.13
85 0.09
86 0.07
87 0.05
88 0.07
89 0.06
90 0.06
91 0.06
92 0.06
93 0.05
94 0.06
95 0.07
96 0.05
97 0.05
98 0.06
99 0.09
100 0.09
101 0.11
102 0.11
103 0.13
104 0.16
105 0.15
106 0.15
107 0.13
108 0.14
109 0.15
110 0.16
111 0.15
112 0.13
113 0.15
114 0.15
115 0.15
116 0.14
117 0.12
118 0.11
119 0.1
120 0.1
121 0.09
122 0.1
123 0.11
124 0.11
125 0.09
126 0.13
127 0.14
128 0.18
129 0.22
130 0.22
131 0.22
132 0.23
133 0.23
134 0.21
135 0.25
136 0.28
137 0.28
138 0.29
139 0.32
140 0.33
141 0.34
142 0.34
143 0.36
144 0.29
145 0.29
146 0.29
147 0.29
148 0.28
149 0.28
150 0.29
151 0.23
152 0.24
153 0.22
154 0.22
155 0.21
156 0.21
157 0.21
158 0.2
159 0.2
160 0.24
161 0.28
162 0.31
163 0.36
164 0.38
165 0.4
166 0.44
167 0.47
168 0.49
169 0.51
170 0.47
171 0.41
172 0.39
173 0.36
174 0.32
175 0.28
176 0.23
177 0.19
178 0.22
179 0.29
180 0.36
181 0.46
182 0.56
183 0.64
184 0.71
185 0.78
186 0.85
187 0.87
188 0.9
189 0.9
190 0.89
191 0.89
192 0.84
193 0.79
194 0.76
195 0.69
196 0.61
197 0.55
198 0.49
199 0.39
200 0.4
201 0.35
202 0.28
203 0.25
204 0.23
205 0.2
206 0.17
207 0.18
208 0.17
209 0.15
210 0.16
211 0.19
212 0.24
213 0.3
214 0.37
215 0.41
216 0.45
217 0.46
218 0.51
219 0.5
220 0.5
221 0.51
222 0.47
223 0.51
224 0.53