Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166GMV4

Protein Details
Accession A0A166GMV4    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
47-66SSPQHQRHVRHQHQHRHEPKBasic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto_nucl 11, mito 4, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013882  Ctp1_C  
IPR033316  RBBP8-like  
Gene Ontology GO:0005634  C:nucleus  
GO:0006281  P:DNA repair  
Pfam View protein in Pfam  
PF08573  SAE2  
Amino Acid Sequences FKYDEVVRGKRRKELDAEDCEECREYYEAIGPMPPRLQAPLWRSPTSSPQHQRHVRHQHQHRHEPKPTALVDSHKQQISRHRAMFARAKTPPGYWDIGFPSTPKVDALNKEAYEMHMKYDMFCLLLVCQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.6
3 0.6
4 0.61
5 0.57
6 0.53
7 0.49
8 0.42
9 0.33
10 0.26
11 0.19
12 0.15
13 0.13
14 0.17
15 0.16
16 0.15
17 0.18
18 0.16
19 0.16
20 0.16
21 0.16
22 0.12
23 0.14
24 0.15
25 0.19
26 0.25
27 0.32
28 0.37
29 0.37
30 0.38
31 0.38
32 0.44
33 0.42
34 0.46
35 0.46
36 0.46
37 0.55
38 0.61
39 0.64
40 0.66
41 0.72
42 0.71
43 0.72
44 0.75
45 0.75
46 0.76
47 0.81
48 0.79
49 0.76
50 0.72
51 0.67
52 0.59
53 0.54
54 0.46
55 0.38
56 0.31
57 0.28
58 0.26
59 0.25
60 0.28
61 0.24
62 0.25
63 0.24
64 0.33
65 0.37
66 0.41
67 0.39
68 0.38
69 0.38
70 0.42
71 0.48
72 0.41
73 0.39
74 0.34
75 0.36
76 0.34
77 0.33
78 0.3
79 0.27
80 0.27
81 0.2
82 0.22
83 0.22
84 0.22
85 0.22
86 0.2
87 0.2
88 0.18
89 0.18
90 0.16
91 0.16
92 0.19
93 0.23
94 0.27
95 0.31
96 0.3
97 0.31
98 0.31
99 0.31
100 0.32
101 0.29
102 0.27
103 0.25
104 0.25
105 0.24
106 0.26
107 0.24
108 0.18
109 0.18
110 0.16