Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166DEX0

Protein Details
Accession A0A166DEX0    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
58-79LFMTQRYHQHRVRQRRRRPVQRHydrophilic
NLS Segment(s)
PositionSequence
71-76QRRRRP
Subcellular Location(s) mito 13.5, mito_nucl 10.833, nucl 7, cyto_nucl 5.833, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR015943  WD40/YVTN_repeat-like_dom_sf  
IPR036322  WD40_repeat_dom_sf  
Amino Acid Sequences MDSTIRLWARPLPTISRQKSFVRSLTIHSTEFSFASGSAGGNNIKKWKYSDGNFVFNLFMTQRYHQHRVRQRRRRPVQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.52
3 0.51
4 0.52
5 0.52
6 0.55
7 0.53
8 0.47
9 0.43
10 0.39
11 0.39
12 0.42
13 0.4
14 0.34
15 0.3
16 0.28
17 0.23
18 0.21
19 0.17
20 0.1
21 0.07
22 0.08
23 0.07
24 0.06
25 0.05
26 0.06
27 0.07
28 0.08
29 0.09
30 0.13
31 0.13
32 0.14
33 0.16
34 0.22
35 0.27
36 0.29
37 0.38
38 0.39
39 0.43
40 0.42
41 0.41
42 0.34
43 0.28
44 0.27
45 0.17
46 0.15
47 0.13
48 0.16
49 0.23
50 0.3
51 0.38
52 0.41
53 0.51
54 0.59
55 0.67
56 0.76
57 0.79
58 0.82
59 0.86