Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177CCW8

Protein Details
Accession A0A177CCW8    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
8-27EDKQTVKRTVPKQNNKIFAVHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 12.5, cyto_nucl 11, nucl 8.5, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011993  PH-like_dom_sf  
IPR033927  WASPfam_EVH1  
IPR000697  WH1/EVH1_dom  
Pfam View protein in Pfam  
PF00568  WH1  
PROSITE View protein in PROSITE  
PS50229  WH1  
CDD cd01205  EVH1_WASP-like  
Amino Acid Sequences MPSILSDEDKQTVKRTVPKQNNKIFAVAVAKLYVAYPDKHTWTYTGLQGAAVLANDLVGNTLWIKLVDISPTSRGVIWDQEIYDTFTYNQDRVFFHTFELEDCLAGLSFA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.45
3 0.52
4 0.6
5 0.69
6 0.75
7 0.78
8 0.81
9 0.74
10 0.67
11 0.56
12 0.48
13 0.4
14 0.31
15 0.23
16 0.16
17 0.14
18 0.12
19 0.12
20 0.11
21 0.1
22 0.1
23 0.14
24 0.16
25 0.19
26 0.2
27 0.21
28 0.2
29 0.21
30 0.22
31 0.19
32 0.18
33 0.15
34 0.14
35 0.13
36 0.12
37 0.09
38 0.06
39 0.05
40 0.03
41 0.03
42 0.03
43 0.03
44 0.03
45 0.03
46 0.03
47 0.03
48 0.04
49 0.04
50 0.04
51 0.05
52 0.05
53 0.06
54 0.07
55 0.08
56 0.09
57 0.1
58 0.12
59 0.12
60 0.11
61 0.12
62 0.12
63 0.14
64 0.14
65 0.14
66 0.13
67 0.14
68 0.15
69 0.17
70 0.15
71 0.14
72 0.13
73 0.16
74 0.18
75 0.18
76 0.19
77 0.18
78 0.19
79 0.25
80 0.29
81 0.24
82 0.23
83 0.26
84 0.25
85 0.23
86 0.27
87 0.21
88 0.16
89 0.16
90 0.16