Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177BZ64

Protein Details
Accession A0A177BZ64    Localization Confidence High Confidence Score 17.5
NoLS Segment(s)
PositionSequenceProtein Nature
19-46GLSKALLSKKKHEKKSKPLDLQQRQEYRHydrophilic
105-142KERITAKKQATRQRKEKEKQNTKKPIQTYQKGKRKALEHydrophilic
NLS Segment(s)
PositionSequence
27-35KKKHEKKSK
74-151QQLKKAHKKAEKALKKVHQLQEKEERARREEKERITAKKQATRQRKEKEKQNTKKPIQTYQKGKRKALEPATKPIQKK
Subcellular Location(s) nucl 20, cyto_nucl 12.5, mito 4
Family & Domain DBs
Amino Acid Sequences RSLHHISIQNELLHTEVEGLSKALLSKKKHEKKSKPLDLQQRQEYRRGAVFWSPSKVREAQFRQRIKDQEAEKQQLKKAHKKAEKALKKVHQLQEKEERARREEKERITAKKQATRQRKEKEKQNTKKPIQTYQKGKRKALEPATKPIQKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.13
3 0.1
4 0.09
5 0.09
6 0.09
7 0.08
8 0.09
9 0.1
10 0.14
11 0.2
12 0.23
13 0.33
14 0.44
15 0.53
16 0.63
17 0.73
18 0.77
19 0.82
20 0.9
21 0.91
22 0.88
23 0.87
24 0.88
25 0.86
26 0.84
27 0.82
28 0.8
29 0.71
30 0.68
31 0.61
32 0.52
33 0.46
34 0.38
35 0.31
36 0.26
37 0.29
38 0.26
39 0.3
40 0.28
41 0.26
42 0.28
43 0.3
44 0.27
45 0.31
46 0.36
47 0.41
48 0.49
49 0.53
50 0.54
51 0.56
52 0.58
53 0.52
54 0.51
55 0.43
56 0.42
57 0.44
58 0.45
59 0.44
60 0.44
61 0.43
62 0.43
63 0.46
64 0.47
65 0.48
66 0.53
67 0.54
68 0.56
69 0.61
70 0.66
71 0.68
72 0.65
73 0.66
74 0.62
75 0.64
76 0.68
77 0.66
78 0.63
79 0.57
80 0.57
81 0.59
82 0.59
83 0.58
84 0.54
85 0.5
86 0.47
87 0.52
88 0.5
89 0.48
90 0.49
91 0.47
92 0.52
93 0.55
94 0.58
95 0.57
96 0.6
97 0.58
98 0.58
99 0.62
100 0.62
101 0.67
102 0.7
103 0.74
104 0.78
105 0.82
106 0.83
107 0.85
108 0.86
109 0.87
110 0.87
111 0.88
112 0.89
113 0.86
114 0.86
115 0.81
116 0.8
117 0.79
118 0.78
119 0.78
120 0.78
121 0.8
122 0.81
123 0.8
124 0.77
125 0.72
126 0.72
127 0.72
128 0.71
129 0.66
130 0.68
131 0.73