Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177C585

Protein Details
Accession A0A177C585    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
3-49AAKKHVPIVKKHTKRFNRHQSDRFKCVDPSWRKPKGIDNRVRRRFKGBasic
NLS Segment(s)
PositionSequence
34-51RKPKGIDNRVRRRFKGQA
Subcellular Location(s) mito 17.5, mito_nucl 12.833, nucl 7, cyto_nucl 5.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVAAKKHVPIVKKHTKRFNRHQSDRFKCVDPSWRKPKGIDNRVRRRFKGQAAMPKIGYGSNKKTRHLMPSGHKAFVVNNARDVDLLLMHNQTFAAEISHSVSARKRIDIIAKAKQLGVKVTNSKARVKTES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.79
3 0.84
4 0.87
5 0.89
6 0.88
7 0.89
8 0.89
9 0.89
10 0.87
11 0.83
12 0.76
13 0.68
14 0.59
15 0.53
16 0.55
17 0.52
18 0.54
19 0.58
20 0.61
21 0.59
22 0.59
23 0.65
24 0.65
25 0.67
26 0.67
27 0.68
28 0.72
29 0.8
30 0.84
31 0.77
32 0.73
33 0.69
34 0.65
35 0.63
36 0.58
37 0.58
38 0.57
39 0.57
40 0.5
41 0.43
42 0.38
43 0.3
44 0.27
45 0.22
46 0.24
47 0.31
48 0.33
49 0.34
50 0.37
51 0.38
52 0.41
53 0.4
54 0.39
55 0.36
56 0.44
57 0.45
58 0.42
59 0.4
60 0.35
61 0.31
62 0.33
63 0.34
64 0.24
65 0.24
66 0.25
67 0.25
68 0.24
69 0.24
70 0.16
71 0.1
72 0.1
73 0.08
74 0.08
75 0.08
76 0.08
77 0.08
78 0.07
79 0.07
80 0.06
81 0.06
82 0.05
83 0.06
84 0.09
85 0.11
86 0.11
87 0.12
88 0.15
89 0.22
90 0.24
91 0.24
92 0.24
93 0.25
94 0.32
95 0.38
96 0.42
97 0.43
98 0.45
99 0.45
100 0.45
101 0.44
102 0.38
103 0.36
104 0.32
105 0.31
106 0.33
107 0.38
108 0.44
109 0.45
110 0.51
111 0.52