Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A177BZK1

Protein Details
Accession A0A177BZK1    Localization Confidence High Confidence Score 18.1
NoLS Segment(s)
PositionSequenceProtein Nature
12-33IEICRRKDARSARIKKNKKAGNHydrophilic
NLS Segment(s)
PositionSequence
17-35RKDARSARIKKNKKAGNIK
73-81KKNPKGKRS
Subcellular Location(s) nucl 21, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MPSEVSDIKQFIEICRRKDARSARIKKNKKAGNIKFKVRCERFIYTLVLKDTDKAEKLKQSLPPGLTISDVGKKNPKGKRSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.43
3 0.45
4 0.42
5 0.5
6 0.55
7 0.54
8 0.6
9 0.66
10 0.67
11 0.75
12 0.83
13 0.82
14 0.83
15 0.78
16 0.77
17 0.78
18 0.77
19 0.77
20 0.75
21 0.77
22 0.74
23 0.74
24 0.74
25 0.65
26 0.61
27 0.55
28 0.52
29 0.46
30 0.41
31 0.39
32 0.3
33 0.31
34 0.26
35 0.22
36 0.19
37 0.18
38 0.17
39 0.17
40 0.18
41 0.18
42 0.21
43 0.24
44 0.27
45 0.31
46 0.34
47 0.37
48 0.41
49 0.39
50 0.39
51 0.35
52 0.32
53 0.28
54 0.24
55 0.21
56 0.23
57 0.23
58 0.24
59 0.31
60 0.36
61 0.44
62 0.5