Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177CF37

Protein Details
Accession A0A177CF37    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MSKTKTKRARRELKRDATRKIANFHydrophilic
32-54VPKPSAPAAKKQKPNNDPKPPATHydrophilic
NLS Segment(s)
PositionSequence
4-50TKTKRARRELKRDATRKIANFQKAAAKSVPKPSAPAAKKQKPNNDPK
281-300GEKKKEEEEGEKKWGKKRAR
Subcellular Location(s) nucl 12.5, mito_nucl 10.5, mito 7.5, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR019446  BMT5-like  
Gene Ontology GO:0070042  F:rRNA (uridine-N3-)-methyltransferase activity  
GO:0070475  P:rRNA base methylation  
Pfam View protein in Pfam  
PF10354  BMT5-like  
Amino Acid Sequences MSKTKTKRARRELKRDATRKIANFQKAAAKSVPKPSAPAAKKQKPNNDPKPPATAVPKPPVQASQKHEVPFGTYDHILLVGEGDFSFTKSLVSEHGCANVTATSFDSDEEVRAKYPTFASIHDELSALTPPVPFHSSVDATKLGSYKALRSSEEREGGWDTIAFMFPHTGGLSTDVNRQVRANQALLVGFFNSCLSAHKGRPFLRDGGRVLVCLFEGEPYTLWNVRDLARHAGLKVVESYKFDSKDYPGYAHVRTLGAIEGGGAWKGEDRRARMFVFEKVGEKKKEEEEGEKKWGKKRARDESESDSDEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.94
2 0.91
3 0.86
4 0.85
5 0.82
6 0.75
7 0.73
8 0.71
9 0.66
10 0.6
11 0.57
12 0.56
13 0.49
14 0.49
15 0.46
16 0.43
17 0.42
18 0.5
19 0.52
20 0.43
21 0.45
22 0.46
23 0.51
24 0.48
25 0.53
26 0.55
27 0.59
28 0.67
29 0.72
30 0.78
31 0.77
32 0.85
33 0.86
34 0.86
35 0.84
36 0.79
37 0.78
38 0.69
39 0.64
40 0.6
41 0.57
42 0.54
43 0.53
44 0.52
45 0.46
46 0.45
47 0.47
48 0.45
49 0.45
50 0.43
51 0.45
52 0.47
53 0.47
54 0.47
55 0.4
56 0.38
57 0.32
58 0.28
59 0.23
60 0.18
61 0.17
62 0.15
63 0.15
64 0.12
65 0.1
66 0.09
67 0.05
68 0.05
69 0.05
70 0.06
71 0.06
72 0.07
73 0.08
74 0.07
75 0.07
76 0.07
77 0.08
78 0.09
79 0.12
80 0.13
81 0.14
82 0.17
83 0.17
84 0.17
85 0.17
86 0.15
87 0.12
88 0.11
89 0.11
90 0.09
91 0.09
92 0.09
93 0.1
94 0.09
95 0.1
96 0.11
97 0.11
98 0.1
99 0.11
100 0.11
101 0.11
102 0.11
103 0.14
104 0.14
105 0.14
106 0.19
107 0.2
108 0.2
109 0.19
110 0.19
111 0.15
112 0.15
113 0.14
114 0.09
115 0.07
116 0.07
117 0.07
118 0.09
119 0.1
120 0.1
121 0.1
122 0.13
123 0.14
124 0.14
125 0.17
126 0.15
127 0.14
128 0.15
129 0.14
130 0.11
131 0.12
132 0.12
133 0.12
134 0.16
135 0.18
136 0.18
137 0.2
138 0.25
139 0.27
140 0.28
141 0.26
142 0.22
143 0.23
144 0.21
145 0.19
146 0.14
147 0.1
148 0.08
149 0.09
150 0.07
151 0.06
152 0.06
153 0.06
154 0.06
155 0.06
156 0.06
157 0.05
158 0.08
159 0.09
160 0.1
161 0.14
162 0.18
163 0.18
164 0.18
165 0.19
166 0.18
167 0.21
168 0.23
169 0.2
170 0.16
171 0.16
172 0.16
173 0.16
174 0.15
175 0.1
176 0.08
177 0.07
178 0.06
179 0.05
180 0.05
181 0.07
182 0.11
183 0.15
184 0.18
185 0.23
186 0.3
187 0.32
188 0.36
189 0.37
190 0.38
191 0.39
192 0.41
193 0.37
194 0.36
195 0.34
196 0.3
197 0.27
198 0.22
199 0.17
200 0.13
201 0.12
202 0.06
203 0.07
204 0.07
205 0.07
206 0.07
207 0.1
208 0.12
209 0.12
210 0.13
211 0.14
212 0.15
213 0.19
214 0.21
215 0.23
216 0.24
217 0.25
218 0.23
219 0.25
220 0.24
221 0.21
222 0.22
223 0.2
224 0.18
225 0.19
226 0.23
227 0.26
228 0.27
229 0.26
230 0.26
231 0.26
232 0.31
233 0.31
234 0.29
235 0.28
236 0.3
237 0.31
238 0.3
239 0.28
240 0.22
241 0.21
242 0.19
243 0.15
244 0.11
245 0.1
246 0.08
247 0.07
248 0.07
249 0.07
250 0.06
251 0.05
252 0.09
253 0.11
254 0.17
255 0.21
256 0.26
257 0.31
258 0.36
259 0.37
260 0.39
261 0.41
262 0.4
263 0.4
264 0.38
265 0.38
266 0.42
267 0.49
268 0.48
269 0.47
270 0.47
271 0.46
272 0.51
273 0.5
274 0.52
275 0.51
276 0.54
277 0.61
278 0.63
279 0.63
280 0.62
281 0.67
282 0.66
283 0.68
284 0.72
285 0.73
286 0.76
287 0.78
288 0.77
289 0.77
290 0.77