Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177C2K2

Protein Details
Accession A0A177C2K2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
146-178QTIKSVKCEKQEKPKPKPKPKPAPKPQPTPVSGHydrophilic
NLS Segment(s)
PositionSequence
157-171EKPKPKPKPKPAPKP
Subcellular Location(s) extr 21, mito 4
Family & Domain DBs
Amino Acid Sequences MRTSFAIFALLSAVPTFATAYPASSSYDSGSPSPSYGSGSSSGSTSPTADAPDFRNDGACTLYKAKNLAGKTSPTDYTPVPADSGCLDLSSLYGAWEGKTRSLVVQEGYKCEFYNDFKCPTTASPLCLNAQTKKITMKTLPKEWDQTIKSVKCEKQEKPKPKPKPKPAPKPQPTPVSGGSSY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.09
4 0.07
5 0.1
6 0.09
7 0.11
8 0.12
9 0.13
10 0.16
11 0.15
12 0.16
13 0.15
14 0.17
15 0.17
16 0.17
17 0.19
18 0.16
19 0.16
20 0.16
21 0.15
22 0.16
23 0.14
24 0.15
25 0.14
26 0.15
27 0.15
28 0.14
29 0.14
30 0.12
31 0.12
32 0.11
33 0.1
34 0.1
35 0.11
36 0.11
37 0.13
38 0.15
39 0.18
40 0.19
41 0.18
42 0.19
43 0.17
44 0.17
45 0.18
46 0.15
47 0.14
48 0.18
49 0.2
50 0.19
51 0.2
52 0.21
53 0.24
54 0.24
55 0.25
56 0.22
57 0.22
58 0.24
59 0.25
60 0.24
61 0.2
62 0.22
63 0.18
64 0.17
65 0.17
66 0.14
67 0.12
68 0.11
69 0.11
70 0.09
71 0.1
72 0.08
73 0.07
74 0.06
75 0.05
76 0.06
77 0.05
78 0.05
79 0.03
80 0.04
81 0.04
82 0.05
83 0.07
84 0.08
85 0.08
86 0.09
87 0.09
88 0.09
89 0.11
90 0.12
91 0.1
92 0.15
93 0.15
94 0.17
95 0.19
96 0.19
97 0.17
98 0.17
99 0.18
100 0.17
101 0.22
102 0.22
103 0.24
104 0.24
105 0.24
106 0.25
107 0.24
108 0.28
109 0.24
110 0.24
111 0.24
112 0.25
113 0.26
114 0.29
115 0.3
116 0.25
117 0.28
118 0.27
119 0.26
120 0.29
121 0.3
122 0.3
123 0.34
124 0.41
125 0.43
126 0.49
127 0.51
128 0.5
129 0.53
130 0.51
131 0.54
132 0.46
133 0.45
134 0.46
135 0.45
136 0.46
137 0.49
138 0.5
139 0.51
140 0.57
141 0.59
142 0.61
143 0.69
144 0.74
145 0.77
146 0.84
147 0.86
148 0.9
149 0.93
150 0.93
151 0.94
152 0.95
153 0.95
154 0.96
155 0.96
156 0.94
157 0.93
158 0.9
159 0.87
160 0.79
161 0.74
162 0.66