Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A177C9U1

Protein Details
Accession A0A177C9U1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
26-45AVAPGRRRFPWRKRVQDTASHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 8, cyto 6, mito_nucl 6, extr 5, cyto_nucl 5
Family & Domain DBs
Amino Acid Sequences MNGSCAVYCASLAMHGGVEGMHDAAAVAPGRRRFPWRKRVQDTASNCVFSNAPP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.06
4 0.05
5 0.05
6 0.05
7 0.04
8 0.03
9 0.03
10 0.03
11 0.03
12 0.05
13 0.05
14 0.05
15 0.07
16 0.1
17 0.12
18 0.14
19 0.22
20 0.3
21 0.4
22 0.5
23 0.59
24 0.67
25 0.72
26 0.8
27 0.79
28 0.79
29 0.75
30 0.72
31 0.66
32 0.57
33 0.5
34 0.42