Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J5JH58

Protein Details
Accession J5JH58    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
19-42HVAAQKDQYKKTKRRGPPNMETVAHydrophilic
NLS Segment(s)
Subcellular Location(s) cysk 10, nucl 9.5, cyto_nucl 7, cyto 3.5, mito 2, plas 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR010997  HRDC-like_sf  
IPR006590  RNA_pol_Rpb4/RPC9_core  
IPR005574  Rpb4/RPC9  
IPR038324  Rpb4/RPC9_sf  
IPR038846  RPC9  
Gene Ontology GO:0005666  C:RNA polymerase III complex  
GO:0000166  F:nucleotide binding  
GO:0006384  P:transcription initiation at RNA polymerase III promoter  
Pfam View protein in Pfam  
PF03874  RNA_pol_Rpb4  
Amino Acid Sequences MKIIEAQSAVLSNYEVYQHVAAQKDQYKKTKRRGPPNMETVARELLQYLRTAPSPLSQTPITYTPSCIKTLIERLQPFELSKGEVVMILNLRPSSVAALNTVIEDMGERYTEDEQEQLVTIISEVLGQFDEPEPQEAADGDTSMQDPDAAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.11
4 0.11
5 0.13
6 0.16
7 0.18
8 0.18
9 0.24
10 0.29
11 0.35
12 0.41
13 0.49
14 0.56
15 0.62
16 0.72
17 0.75
18 0.78
19 0.82
20 0.86
21 0.86
22 0.85
23 0.84
24 0.8
25 0.72
26 0.64
27 0.55
28 0.47
29 0.37
30 0.28
31 0.21
32 0.16
33 0.15
34 0.14
35 0.12
36 0.11
37 0.11
38 0.12
39 0.12
40 0.13
41 0.16
42 0.16
43 0.18
44 0.17
45 0.17
46 0.19
47 0.2
48 0.21
49 0.17
50 0.19
51 0.2
52 0.22
53 0.22
54 0.2
55 0.18
56 0.17
57 0.24
58 0.26
59 0.27
60 0.26
61 0.27
62 0.28
63 0.28
64 0.26
65 0.21
66 0.17
67 0.12
68 0.11
69 0.09
70 0.08
71 0.08
72 0.07
73 0.07
74 0.07
75 0.06
76 0.07
77 0.07
78 0.07
79 0.06
80 0.06
81 0.07
82 0.08
83 0.08
84 0.08
85 0.09
86 0.09
87 0.09
88 0.09
89 0.07
90 0.05
91 0.05
92 0.05
93 0.05
94 0.05
95 0.05
96 0.07
97 0.08
98 0.09
99 0.09
100 0.09
101 0.09
102 0.09
103 0.1
104 0.08
105 0.07
106 0.06
107 0.06
108 0.05
109 0.05
110 0.05
111 0.05
112 0.05
113 0.06
114 0.06
115 0.07
116 0.08
117 0.11
118 0.11
119 0.13
120 0.13
121 0.13
122 0.14
123 0.13
124 0.14
125 0.12
126 0.11
127 0.09
128 0.1
129 0.1
130 0.1
131 0.1