Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177CXW9

Protein Details
Accession A0A177CXW9    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
217-242GDDAEPKKRKIPNKKQLEQKVNNWKNHydrophilic
NLS Segment(s)
PositionSequence
223-231KKRKIPNKK
Subcellular Location(s) nucl 15.5, cyto_nucl 10.5, cyto 4.5, pero 3, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR014002  Agenet_dom_plant  
IPR002999  Tudor  
PROSITE View protein in PROSITE  
PS50304  TUDOR  
Amino Acid Sequences MAQDLQKLKNDIWYAKQALEKQEASHAEWAAQYDQVQKILEADPNNEDVAAMVAEIKEAMSQEEAKLGPLREQLKALEAQLPKGNAAPERKYDPEQHPLLKKTLEKAEPAKAAVYNTGDIIEARFFDGLWYKAKIMTILGSSSAPKYKINYVEYNEDATVDRDAIRPIQNKRKRELEPTTTSAPAAAPAPVTSTPHVISGPASVNPKTQQAKADTPGDDAEPKKRKIPNKKQLEQKVNNWKNWNSKGVGKKISQKDSMFRTGTNVNSRVGFTGSGSGMTETSKRVRYDNKAAADADREQD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.41
3 0.46
4 0.43
5 0.45
6 0.48
7 0.43
8 0.37
9 0.42
10 0.4
11 0.38
12 0.38
13 0.33
14 0.27
15 0.27
16 0.27
17 0.21
18 0.2
19 0.18
20 0.18
21 0.2
22 0.21
23 0.21
24 0.18
25 0.2
26 0.21
27 0.24
28 0.2
29 0.21
30 0.21
31 0.22
32 0.22
33 0.19
34 0.16
35 0.12
36 0.11
37 0.09
38 0.06
39 0.05
40 0.05
41 0.05
42 0.05
43 0.05
44 0.05
45 0.05
46 0.06
47 0.07
48 0.09
49 0.09
50 0.12
51 0.12
52 0.13
53 0.17
54 0.16
55 0.17
56 0.22
57 0.25
58 0.23
59 0.24
60 0.23
61 0.23
62 0.23
63 0.21
64 0.22
65 0.2
66 0.22
67 0.23
68 0.23
69 0.21
70 0.21
71 0.22
72 0.2
73 0.24
74 0.25
75 0.26
76 0.3
77 0.33
78 0.35
79 0.4
80 0.4
81 0.43
82 0.44
83 0.46
84 0.47
85 0.46
86 0.45
87 0.42
88 0.39
89 0.36
90 0.39
91 0.35
92 0.33
93 0.34
94 0.37
95 0.35
96 0.34
97 0.3
98 0.24
99 0.22
100 0.2
101 0.18
102 0.12
103 0.11
104 0.11
105 0.1
106 0.09
107 0.09
108 0.07
109 0.06
110 0.06
111 0.06
112 0.05
113 0.06
114 0.08
115 0.09
116 0.11
117 0.12
118 0.12
119 0.13
120 0.13
121 0.13
122 0.11
123 0.1
124 0.09
125 0.08
126 0.08
127 0.07
128 0.08
129 0.09
130 0.1
131 0.1
132 0.1
133 0.12
134 0.15
135 0.2
136 0.23
137 0.26
138 0.27
139 0.3
140 0.3
141 0.3
142 0.25
143 0.21
144 0.17
145 0.14
146 0.12
147 0.08
148 0.08
149 0.07
150 0.08
151 0.1
152 0.14
153 0.19
154 0.25
155 0.35
156 0.42
157 0.45
158 0.49
159 0.55
160 0.53
161 0.56
162 0.58
163 0.55
164 0.54
165 0.54
166 0.53
167 0.45
168 0.42
169 0.33
170 0.25
171 0.18
172 0.13
173 0.09
174 0.06
175 0.06
176 0.08
177 0.09
178 0.11
179 0.11
180 0.12
181 0.12
182 0.13
183 0.13
184 0.11
185 0.11
186 0.12
187 0.12
188 0.13
189 0.15
190 0.15
191 0.17
192 0.19
193 0.25
194 0.26
195 0.26
196 0.29
197 0.31
198 0.35
199 0.37
200 0.41
201 0.34
202 0.33
203 0.32
204 0.28
205 0.27
206 0.24
207 0.29
208 0.32
209 0.33
210 0.38
211 0.44
212 0.52
213 0.6
214 0.69
215 0.7
216 0.74
217 0.8
218 0.84
219 0.88
220 0.89
221 0.84
222 0.82
223 0.84
224 0.8
225 0.78
226 0.74
227 0.69
228 0.68
229 0.66
230 0.61
231 0.53
232 0.53
233 0.56
234 0.58
235 0.59
236 0.54
237 0.59
238 0.62
239 0.66
240 0.65
241 0.6
242 0.59
243 0.59
244 0.62
245 0.53
246 0.45
247 0.42
248 0.4
249 0.43
250 0.44
251 0.39
252 0.33
253 0.33
254 0.33
255 0.31
256 0.27
257 0.22
258 0.15
259 0.17
260 0.15
261 0.15
262 0.15
263 0.14
264 0.13
265 0.14
266 0.15
267 0.15
268 0.2
269 0.25
270 0.26
271 0.32
272 0.4
273 0.47
274 0.56
275 0.61
276 0.6
277 0.58
278 0.58
279 0.54
280 0.5