Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177C642

Protein Details
Accession A0A177C642    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
15-40LLWKVPWRLSRHQKYRHRERLRGVDSHydrophilic
77-103KYTVFDRKVKRYRKGIHKVPKWTRVSQHydrophilic
NLS Segment(s)
PositionSequence
85-94VKRYRKGIHK
Subcellular Location(s) mito 20, cyto 3.5, cyto_nucl 3.5, nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGPFRLTNPLSGGLLWKVPWRLSRHQKYRHRERLRGVDSIVSTVDSALARLGQSLKKVEAWKKDMPTEQEMLPRDKYTVFDRKVKRYRKGIHKVPKWTRVSQRLNPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.16
4 0.17
5 0.17
6 0.19
7 0.25
8 0.29
9 0.38
10 0.48
11 0.58
12 0.64
13 0.72
14 0.79
15 0.84
16 0.89
17 0.9
18 0.88
19 0.83
20 0.81
21 0.81
22 0.75
23 0.67
24 0.56
25 0.48
26 0.4
27 0.34
28 0.26
29 0.16
30 0.12
31 0.1
32 0.1
33 0.06
34 0.06
35 0.05
36 0.05
37 0.05
38 0.06
39 0.07
40 0.07
41 0.09
42 0.1
43 0.11
44 0.14
45 0.18
46 0.23
47 0.27
48 0.32
49 0.35
50 0.37
51 0.4
52 0.4
53 0.39
54 0.38
55 0.34
56 0.29
57 0.3
58 0.3
59 0.3
60 0.28
61 0.25
62 0.22
63 0.21
64 0.22
65 0.23
66 0.3
67 0.31
68 0.38
69 0.44
70 0.53
71 0.62
72 0.69
73 0.71
74 0.71
75 0.77
76 0.8
77 0.84
78 0.84
79 0.85
80 0.85
81 0.88
82 0.87
83 0.87
84 0.82
85 0.8
86 0.8
87 0.79
88 0.8
89 0.77
90 0.79