Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177CVP0

Protein Details
Accession A0A177CVP0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
41-63VGFRVRLQRRRWRRSSNPGYHGHHydrophilic
NLS Segment(s)
PositionSequence
49-54RRRWRR
Subcellular Location(s) extr 18, cyto_mito 4.333, cyto 4, mito 3.5, cyto_nucl 3.333
Family & Domain DBs
Amino Acid Sequences MVVQPSGNLNSAWLRLVALQDSAGRPIGRPSPLRHTNAANVGFRVRLQRRRWRRSSNPGYHGHGGRRFGKAVTGGFWASNRASPATET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.13
4 0.12
5 0.1
6 0.1
7 0.12
8 0.12
9 0.13
10 0.14
11 0.13
12 0.12
13 0.15
14 0.18
15 0.2
16 0.23
17 0.26
18 0.33
19 0.4
20 0.43
21 0.42
22 0.4
23 0.39
24 0.42
25 0.41
26 0.32
27 0.26
28 0.23
29 0.21
30 0.19
31 0.23
32 0.23
33 0.28
34 0.34
35 0.44
36 0.54
37 0.64
38 0.72
39 0.74
40 0.78
41 0.81
42 0.85
43 0.84
44 0.8
45 0.76
46 0.73
47 0.68
48 0.62
49 0.57
50 0.5
51 0.46
52 0.42
53 0.4
54 0.35
55 0.31
56 0.3
57 0.27
58 0.24
59 0.21
60 0.21
61 0.19
62 0.18
63 0.19
64 0.19
65 0.17
66 0.19
67 0.18
68 0.17