Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A177C888

Protein Details
Accession A0A177C888    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MAPAPTGGKKQKKKWSKGKVKDKAQHAVVHydrophilic
NLS Segment(s)
PositionSequence
8-23GKKQKKKWSKGKVKDK
Subcellular Location(s) nucl 12, cyto 8, mito 5, cyto_pero 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPAPTGGKKQKKKWSKGKVKDKAQHAVVLDKQTSDKLNKDVQSYRLITVATLVDRLKINGSLARQALNDLEEKGTIRKVVGHSKLSIYTRDVAGEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.88
3 0.89
4 0.91
5 0.93
6 0.92
7 0.92
8 0.89
9 0.85
10 0.82
11 0.72
12 0.65
13 0.55
14 0.5
15 0.42
16 0.38
17 0.32
18 0.25
19 0.23
20 0.21
21 0.23
22 0.2
23 0.19
24 0.19
25 0.25
26 0.26
27 0.29
28 0.3
29 0.3
30 0.33
31 0.32
32 0.28
33 0.24
34 0.22
35 0.18
36 0.16
37 0.14
38 0.09
39 0.09
40 0.08
41 0.09
42 0.09
43 0.1
44 0.09
45 0.09
46 0.1
47 0.11
48 0.12
49 0.14
50 0.15
51 0.16
52 0.15
53 0.15
54 0.15
55 0.13
56 0.14
57 0.11
58 0.11
59 0.1
60 0.11
61 0.12
62 0.13
63 0.13
64 0.12
65 0.15
66 0.19
67 0.28
68 0.33
69 0.35
70 0.35
71 0.38
72 0.43
73 0.41
74 0.39
75 0.33
76 0.3
77 0.28