Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A177C2J5

Protein Details
Accession A0A177C2J5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
40-67LWKFCGKFRAHYHRRRRRQRSFELEAQLHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 9, mito 5, E.R. 4, extr 3, cyto_mito 3, mito_nucl 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPALTFRPRNPPPPPIAELLQTTFEGLAALVACLALAFTLWKFCGKFRAHYHRRRRRQRSFELEAQLPEVWVTSMG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.5
3 0.47
4 0.42
5 0.38
6 0.33
7 0.29
8 0.22
9 0.19
10 0.14
11 0.13
12 0.1
13 0.07
14 0.06
15 0.04
16 0.04
17 0.03
18 0.03
19 0.03
20 0.03
21 0.03
22 0.02
23 0.02
24 0.02
25 0.02
26 0.03
27 0.04
28 0.06
29 0.07
30 0.08
31 0.16
32 0.18
33 0.25
34 0.33
35 0.45
36 0.53
37 0.62
38 0.73
39 0.76
40 0.85
41 0.89
42 0.91
43 0.91
44 0.92
45 0.92
46 0.9
47 0.88
48 0.84
49 0.8
50 0.72
51 0.61
52 0.54
53 0.44
54 0.34
55 0.26
56 0.18