Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177C7I6

Protein Details
Accession A0A177C7I6   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MPPKRRAPPSRQAAPKRPSKLHydrophilic
NLS Segment(s)
PositionSequence
4-21KRRAPPSRQAAPKRPSKL
Subcellular Location(s) nucl 14, cyto 7, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR011992  EF-hand-dom_pair  
Amino Acid Sequences MPPKRRAPPSRQAAPKRPSKLAKEHGLTADQEAEIREAFGLFAVQHPDHEDSKEGVLRRDDVRRCLISLNLTPEKSELPEILSTIDPLETGFVPFEPFFAYAAIAIHSKDDSEGEDDDNEDEEDNYHGENDQVQVNAAFKLFTHGGPGPITLAHLRRVAKELKEDVPDDVLKDMIREANGGAKGKGRDTGGVEVEEFESVMRRAGVSFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.84
3 0.8
4 0.79
5 0.77
6 0.74
7 0.74
8 0.73
9 0.74
10 0.68
11 0.66
12 0.6
13 0.55
14 0.48
15 0.4
16 0.33
17 0.23
18 0.2
19 0.16
20 0.15
21 0.12
22 0.11
23 0.09
24 0.07
25 0.07
26 0.06
27 0.06
28 0.05
29 0.07
30 0.11
31 0.11
32 0.12
33 0.15
34 0.18
35 0.19
36 0.2
37 0.2
38 0.17
39 0.2
40 0.23
41 0.21
42 0.21
43 0.21
44 0.23
45 0.25
46 0.32
47 0.32
48 0.33
49 0.38
50 0.36
51 0.35
52 0.33
53 0.31
54 0.27
55 0.27
56 0.3
57 0.29
58 0.27
59 0.26
60 0.26
61 0.25
62 0.22
63 0.2
64 0.12
65 0.1
66 0.11
67 0.11
68 0.11
69 0.11
70 0.1
71 0.09
72 0.08
73 0.06
74 0.06
75 0.06
76 0.05
77 0.05
78 0.05
79 0.05
80 0.07
81 0.06
82 0.07
83 0.07
84 0.07
85 0.07
86 0.07
87 0.07
88 0.06
89 0.06
90 0.07
91 0.06
92 0.05
93 0.05
94 0.05
95 0.05
96 0.05
97 0.05
98 0.05
99 0.07
100 0.08
101 0.08
102 0.08
103 0.08
104 0.09
105 0.09
106 0.08
107 0.06
108 0.06
109 0.06
110 0.06
111 0.06
112 0.06
113 0.05
114 0.05
115 0.05
116 0.06
117 0.07
118 0.07
119 0.07
120 0.07
121 0.08
122 0.08
123 0.09
124 0.08
125 0.07
126 0.05
127 0.1
128 0.1
129 0.1
130 0.13
131 0.13
132 0.15
133 0.16
134 0.16
135 0.12
136 0.11
137 0.13
138 0.12
139 0.13
140 0.14
141 0.18
142 0.19
143 0.2
144 0.25
145 0.28
146 0.28
147 0.32
148 0.34
149 0.33
150 0.36
151 0.35
152 0.33
153 0.32
154 0.29
155 0.24
156 0.2
157 0.17
158 0.13
159 0.13
160 0.13
161 0.11
162 0.11
163 0.11
164 0.11
165 0.15
166 0.19
167 0.2
168 0.2
169 0.23
170 0.24
171 0.25
172 0.28
173 0.24
174 0.24
175 0.26
176 0.3
177 0.27
178 0.27
179 0.26
180 0.23
181 0.23
182 0.19
183 0.15
184 0.1
185 0.1
186 0.1
187 0.11
188 0.1
189 0.09