Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A177BYV5

Protein Details
Accession A0A177BYV5    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
25-48MPEKTRGRPKNSRDKVPRNRKGEGBasic
NLS Segment(s)
PositionSequence
26-66PEKTRGRPKNSRDKVPRNRKGEGLAKKPTWAKSGRPSKQQK
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 4
Family & Domain DBs
Amino Acid Sequences MDAELGSQQPSMQHTPQQLLEKPGMPEKTRGRPKNSRDKVPRNRKGEGLAKKPTWAKSGRPSKQQKQALEERKALKYLIDREEQMFGISNPELNACLQKLEGQARLKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.3
3 0.35
4 0.39
5 0.37
6 0.36
7 0.37
8 0.35
9 0.34
10 0.37
11 0.36
12 0.31
13 0.36
14 0.39
15 0.47
16 0.54
17 0.58
18 0.61
19 0.66
20 0.73
21 0.77
22 0.77
23 0.77
24 0.77
25 0.82
26 0.84
27 0.86
28 0.86
29 0.81
30 0.76
31 0.67
32 0.63
33 0.61
34 0.58
35 0.53
36 0.5
37 0.45
38 0.46
39 0.47
40 0.43
41 0.38
42 0.33
43 0.3
44 0.34
45 0.44
46 0.46
47 0.53
48 0.6
49 0.63
50 0.71
51 0.73
52 0.66
53 0.63
54 0.68
55 0.67
56 0.63
57 0.61
58 0.56
59 0.51
60 0.49
61 0.42
62 0.34
63 0.31
64 0.32
65 0.31
66 0.29
67 0.29
68 0.3
69 0.32
70 0.29
71 0.24
72 0.19
73 0.14
74 0.15
75 0.14
76 0.13
77 0.11
78 0.12
79 0.12
80 0.12
81 0.15
82 0.12
83 0.13
84 0.12
85 0.15
86 0.2
87 0.24
88 0.29