Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177BX58

Protein Details
Accession A0A177BX58    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
44-64QHDSNLHPRRRRARTVGPFEIHydrophilic
292-314NSTTRSSSKERRAVKKVRQTGPLHydrophilic
NLS Segment(s)
PositionSequence
302-302R
Subcellular Location(s) cyto 9.5, cyto_nucl 8, nucl 5.5, mito 5, extr 3, pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MVSSAGLPHRHHSEDSWVEVASCPSSSSLSSAADEIITTGLRVQHDSNLHPRRRRARTVGPFEIGTGYRVASAGGNSSQEEYDESESESDRVMTSSNEGIGPSPLQNELRRSSSVASSEPLSEREGDDEGESDDENATAVNYPRSSRRQFAPRPNAFSHPSEQPSIRSQSGTVYTPRRPSARPSSQRHSYPQHTPYNAVSPNAQADHDEALRASLSTLLTAAAAVRGLPKPGQPRPISSHPSGHPTSLRLVPESVALGDIAEDDSTGAPLSPRTVSSSPSEKSKRKASPANNSTTRSSSKERRAVKKVRQTGPLVEEISPTLLTWVVGAGAVVLVSALSFSAGYVVGKEVGHTEAMGQLGSVGGDAGRCGKEAASGLRGAGMGLRRLRWTGGSGVRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.41
3 0.37
4 0.32
5 0.29
6 0.29
7 0.28
8 0.2
9 0.16
10 0.12
11 0.12
12 0.13
13 0.13
14 0.14
15 0.15
16 0.15
17 0.16
18 0.16
19 0.15
20 0.14
21 0.13
22 0.11
23 0.1
24 0.08
25 0.07
26 0.09
27 0.11
28 0.12
29 0.15
30 0.16
31 0.2
32 0.24
33 0.29
34 0.37
35 0.44
36 0.51
37 0.56
38 0.64
39 0.68
40 0.74
41 0.78
42 0.76
43 0.77
44 0.8
45 0.83
46 0.8
47 0.73
48 0.64
49 0.56
50 0.5
51 0.39
52 0.29
53 0.21
54 0.14
55 0.11
56 0.11
57 0.11
58 0.09
59 0.08
60 0.1
61 0.1
62 0.12
63 0.12
64 0.13
65 0.13
66 0.12
67 0.13
68 0.13
69 0.15
70 0.14
71 0.14
72 0.14
73 0.15
74 0.15
75 0.14
76 0.12
77 0.09
78 0.09
79 0.09
80 0.08
81 0.1
82 0.11
83 0.11
84 0.11
85 0.11
86 0.11
87 0.12
88 0.12
89 0.11
90 0.11
91 0.12
92 0.15
93 0.18
94 0.22
95 0.24
96 0.26
97 0.26
98 0.27
99 0.27
100 0.26
101 0.25
102 0.22
103 0.2
104 0.18
105 0.19
106 0.18
107 0.18
108 0.16
109 0.15
110 0.14
111 0.14
112 0.14
113 0.12
114 0.11
115 0.1
116 0.1
117 0.1
118 0.09
119 0.08
120 0.07
121 0.06
122 0.06
123 0.05
124 0.05
125 0.06
126 0.07
127 0.09
128 0.09
129 0.11
130 0.17
131 0.24
132 0.27
133 0.29
134 0.35
135 0.43
136 0.5
137 0.6
138 0.65
139 0.64
140 0.67
141 0.66
142 0.64
143 0.57
144 0.51
145 0.44
146 0.38
147 0.35
148 0.31
149 0.29
150 0.27
151 0.27
152 0.29
153 0.26
154 0.21
155 0.19
156 0.2
157 0.21
158 0.21
159 0.21
160 0.22
161 0.24
162 0.28
163 0.3
164 0.31
165 0.3
166 0.34
167 0.4
168 0.46
169 0.52
170 0.56
171 0.6
172 0.64
173 0.66
174 0.64
175 0.6
176 0.54
177 0.52
178 0.52
179 0.51
180 0.45
181 0.44
182 0.39
183 0.39
184 0.35
185 0.29
186 0.22
187 0.17
188 0.17
189 0.16
190 0.14
191 0.09
192 0.09
193 0.1
194 0.1
195 0.09
196 0.07
197 0.07
198 0.07
199 0.07
200 0.05
201 0.05
202 0.05
203 0.05
204 0.06
205 0.05
206 0.05
207 0.05
208 0.05
209 0.03
210 0.03
211 0.03
212 0.06
213 0.06
214 0.07
215 0.08
216 0.11
217 0.18
218 0.22
219 0.3
220 0.29
221 0.34
222 0.4
223 0.47
224 0.49
225 0.44
226 0.46
227 0.4
228 0.45
229 0.41
230 0.36
231 0.3
232 0.26
233 0.27
234 0.25
235 0.24
236 0.19
237 0.18
238 0.16
239 0.16
240 0.15
241 0.12
242 0.08
243 0.07
244 0.06
245 0.05
246 0.05
247 0.04
248 0.04
249 0.04
250 0.04
251 0.04
252 0.04
253 0.04
254 0.04
255 0.04
256 0.05
257 0.07
258 0.07
259 0.08
260 0.14
261 0.15
262 0.17
263 0.21
264 0.27
265 0.27
266 0.35
267 0.43
268 0.42
269 0.47
270 0.54
271 0.57
272 0.58
273 0.66
274 0.66
275 0.69
276 0.72
277 0.75
278 0.72
279 0.68
280 0.63
281 0.58
282 0.52
283 0.46
284 0.47
285 0.46
286 0.5
287 0.55
288 0.61
289 0.66
290 0.73
291 0.78
292 0.8
293 0.82
294 0.82
295 0.8
296 0.78
297 0.72
298 0.68
299 0.62
300 0.57
301 0.49
302 0.39
303 0.33
304 0.27
305 0.25
306 0.19
307 0.15
308 0.1
309 0.08
310 0.08
311 0.07
312 0.06
313 0.05
314 0.05
315 0.05
316 0.04
317 0.03
318 0.03
319 0.03
320 0.03
321 0.02
322 0.02
323 0.02
324 0.02
325 0.03
326 0.03
327 0.03
328 0.04
329 0.05
330 0.05
331 0.06
332 0.07
333 0.09
334 0.09
335 0.1
336 0.1
337 0.11
338 0.11
339 0.11
340 0.1
341 0.1
342 0.11
343 0.1
344 0.08
345 0.07
346 0.07
347 0.07
348 0.06
349 0.04
350 0.04
351 0.04
352 0.05
353 0.09
354 0.09
355 0.1
356 0.11
357 0.11
358 0.14
359 0.17
360 0.21
361 0.2
362 0.2
363 0.2
364 0.21
365 0.2
366 0.17
367 0.18
368 0.16
369 0.19
370 0.22
371 0.25
372 0.26
373 0.27
374 0.29
375 0.28
376 0.28
377 0.3