Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A177BUG3

Protein Details
Accession A0A177BUG3    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
97-122KMEEKMHKKRVERLKRREKRNKMLASBasic
NLS Segment(s)
PositionSequence
25-119RKNGKQWHDNKKAFRPRANQSSFEKRAAERKALDATKAKIKEMKDEKEAERQRRVEAIRTKRAAKEERERFAKMEEKMHKKRVERLKRREKRNKM
Subcellular Location(s) nucl 16.5, cyto_nucl 11.5, cyto 5.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MSTAVETQAAPVAEVSAVSAVKGMRKNGKQWHDNKKAFRPRANQSSFEKRAAERKALDATKAKIKEMKDEKEAERQRRVEAIRTKRAAKEERERFAKMEEKMHKKRVERLKRREKRNKMLAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.07
4 0.07
5 0.06
6 0.08
7 0.08
8 0.13
9 0.16
10 0.2
11 0.28
12 0.31
13 0.39
14 0.47
15 0.55
16 0.59
17 0.65
18 0.71
19 0.73
20 0.76
21 0.76
22 0.77
23 0.79
24 0.77
25 0.75
26 0.71
27 0.69
28 0.72
29 0.7
30 0.64
31 0.6
32 0.64
33 0.6
34 0.55
35 0.48
36 0.39
37 0.43
38 0.41
39 0.38
40 0.29
41 0.28
42 0.32
43 0.3
44 0.31
45 0.27
46 0.26
47 0.29
48 0.28
49 0.26
50 0.24
51 0.24
52 0.31
53 0.35
54 0.37
55 0.34
56 0.38
57 0.4
58 0.46
59 0.53
60 0.49
61 0.5
62 0.47
63 0.44
64 0.46
65 0.45
66 0.44
67 0.46
68 0.49
69 0.5
70 0.53
71 0.55
72 0.52
73 0.58
74 0.56
75 0.55
76 0.57
77 0.57
78 0.61
79 0.63
80 0.61
81 0.55
82 0.53
83 0.52
84 0.44
85 0.45
86 0.47
87 0.52
88 0.58
89 0.65
90 0.67
91 0.64
92 0.71
93 0.73
94 0.75
95 0.76
96 0.79
97 0.82
98 0.85
99 0.92
100 0.94
101 0.93
102 0.93