Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A177BYU2

Protein Details
Accession A0A177BYU2    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
154-184EKGWVHRYTTARKRRERRNIVRTKNFRVLKLHydrophilic
NLS Segment(s)
PositionSequence
165-171RKRRERR
Subcellular Location(s) cysk 17, cyto 6, nucl 4
Family & Domain DBs
Amino Acid Sequences MAGIVDLGIPPVPPLSYWEPETPSPLSPHNPFLSPPAVSPGSPRTDILPLLAASPSTVDRQTAPRSWLFAVALASPCAGTDLSPRFLNPRTPPLPPIMERGLQVQRRHSTMCSIPSSELEKMRHQSLFAVMATVQEKIRKEMNIEREEGLTGREKGWVHRYTTARKRRERRNIVRTKNFRVLKLVDVEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.18
3 0.21
4 0.25
5 0.29
6 0.32
7 0.33
8 0.37
9 0.33
10 0.29
11 0.29
12 0.28
13 0.31
14 0.3
15 0.35
16 0.33
17 0.32
18 0.3
19 0.32
20 0.31
21 0.26
22 0.23
23 0.23
24 0.22
25 0.21
26 0.23
27 0.24
28 0.25
29 0.25
30 0.25
31 0.22
32 0.23
33 0.23
34 0.21
35 0.18
36 0.14
37 0.14
38 0.13
39 0.11
40 0.08
41 0.09
42 0.1
43 0.09
44 0.09
45 0.09
46 0.11
47 0.16
48 0.2
49 0.22
50 0.24
51 0.23
52 0.25
53 0.25
54 0.25
55 0.2
56 0.17
57 0.15
58 0.13
59 0.13
60 0.11
61 0.1
62 0.08
63 0.08
64 0.07
65 0.06
66 0.05
67 0.09
68 0.11
69 0.14
70 0.14
71 0.14
72 0.16
73 0.18
74 0.23
75 0.21
76 0.27
77 0.27
78 0.28
79 0.29
80 0.3
81 0.31
82 0.27
83 0.28
84 0.23
85 0.22
86 0.21
87 0.24
88 0.27
89 0.29
90 0.29
91 0.31
92 0.31
93 0.32
94 0.33
95 0.29
96 0.26
97 0.25
98 0.28
99 0.24
100 0.23
101 0.22
102 0.22
103 0.25
104 0.24
105 0.25
106 0.23
107 0.25
108 0.27
109 0.29
110 0.27
111 0.24
112 0.23
113 0.2
114 0.2
115 0.16
116 0.14
117 0.11
118 0.13
119 0.13
120 0.13
121 0.12
122 0.13
123 0.14
124 0.16
125 0.2
126 0.19
127 0.23
128 0.29
129 0.37
130 0.37
131 0.38
132 0.37
133 0.34
134 0.34
135 0.29
136 0.24
137 0.2
138 0.17
139 0.15
140 0.19
141 0.19
142 0.23
143 0.31
144 0.33
145 0.32
146 0.39
147 0.45
148 0.5
149 0.6
150 0.66
151 0.67
152 0.73
153 0.79
154 0.82
155 0.88
156 0.89
157 0.89
158 0.91
159 0.92
160 0.93
161 0.94
162 0.92
163 0.89
164 0.88
165 0.81
166 0.72
167 0.68
168 0.6
169 0.54