Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A177CL03

Protein Details
Accession A0A177CL03    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MPPRHRRAKRAKPCTIKPVKKTNFBasic
NLS Segment(s)
PositionSequence
4-12RHRRAKRAK
Subcellular Location(s) mito 11, cyto 8.5, cyto_nucl 8.5, nucl 7.5
Family & Domain DBs
Amino Acid Sequences MPPRHRRAKRAKPCTIKPVKKTNFDIALEAIRAELKRDYTFYEEALLGVIRAKAAGGDATPWQVLTRYGGYALIAF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.89
3 0.86
4 0.83
5 0.83
6 0.79
7 0.77
8 0.75
9 0.71
10 0.66
11 0.58
12 0.52
13 0.42
14 0.37
15 0.29
16 0.23
17 0.16
18 0.11
19 0.1
20 0.1
21 0.09
22 0.1
23 0.1
24 0.11
25 0.13
26 0.16
27 0.16
28 0.15
29 0.16
30 0.13
31 0.13
32 0.12
33 0.1
34 0.06
35 0.07
36 0.06
37 0.05
38 0.05
39 0.04
40 0.04
41 0.05
42 0.05
43 0.04
44 0.06
45 0.07
46 0.09
47 0.09
48 0.09
49 0.09
50 0.1
51 0.1
52 0.13
53 0.14
54 0.13
55 0.14
56 0.14