Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J4URW4

Protein Details
Accession J4URW4    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
47-72IHYATLKPEQKKKKNKEKKGGAAAARHydrophilic
NLS Segment(s)
PositionSequence
55-81EQKKKKNKEKKGGAAAARGRGGDNARK
Subcellular Location(s) cyto 9.5, extr 7, cyto_nucl 6, mito 4, E.R. 3, nucl 1.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MVKFDFLRSVGATKEAVAVLNDQPNLFTNLIVVLIGLGVQATLLWYIHYATLKPEQKKKKNKEKKGGAAAARGRGGDNARK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.13
3 0.12
4 0.11
5 0.13
6 0.13
7 0.16
8 0.16
9 0.14
10 0.15
11 0.15
12 0.18
13 0.16
14 0.13
15 0.1
16 0.09
17 0.1
18 0.09
19 0.07
20 0.03
21 0.03
22 0.03
23 0.02
24 0.02
25 0.02
26 0.02
27 0.02
28 0.02
29 0.02
30 0.02
31 0.03
32 0.03
33 0.04
34 0.05
35 0.06
36 0.06
37 0.09
38 0.18
39 0.24
40 0.3
41 0.38
42 0.48
43 0.58
44 0.68
45 0.77
46 0.79
47 0.84
48 0.9
49 0.92
50 0.92
51 0.92
52 0.91
53 0.88
54 0.8
55 0.77
56 0.71
57 0.65
58 0.55
59 0.46
60 0.36
61 0.32