Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A177CXJ3

Protein Details
Accession A0A177CXJ3    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
238-258ASKKPVQKYKPAQRYEPPAKAHydrophilic
NLS Segment(s)
PositionSequence
77-86TARRPAAHRS
93-99TKPKAPV
107-114GAKKTPAG
123-124KR
Subcellular Location(s) mito 16, cyto_nucl 7, cyto 6.5, nucl 4.5
Family & Domain DBs
Amino Acid Sequences MTDFVKNMIWNSVSGFVEEGKRTVGGFAGDALIKAGDMVEGGGRTVGNGIEKKATGLGTAIGGAPPKAPSAKALPSTARRPAAHRSSSLPANTKPKAPVGGSGVPLGAKKTPAGAAAGAAAVKRAAGSGVPLGAKKTPANGALPKFTPKPFNPPGGVSKPSPYPTSGGKPNASTSSLPKAYPSSGTGGAGNPLPKPYPGAGSKTPVRPGQSKPFSGAATSVGGAVKPYPGTNTLPGQASKKPVQKYKPAQRYEPPAKAGEVKSFF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.18
4 0.22
5 0.22
6 0.2
7 0.16
8 0.17
9 0.16
10 0.16
11 0.15
12 0.11
13 0.1
14 0.1
15 0.11
16 0.1
17 0.1
18 0.1
19 0.08
20 0.07
21 0.07
22 0.06
23 0.04
24 0.04
25 0.04
26 0.05
27 0.05
28 0.05
29 0.06
30 0.06
31 0.06
32 0.07
33 0.07
34 0.11
35 0.12
36 0.14
37 0.16
38 0.16
39 0.16
40 0.18
41 0.17
42 0.13
43 0.12
44 0.11
45 0.09
46 0.09
47 0.09
48 0.07
49 0.08
50 0.07
51 0.08
52 0.08
53 0.09
54 0.09
55 0.09
56 0.11
57 0.16
58 0.21
59 0.23
60 0.26
61 0.3
62 0.34
63 0.39
64 0.43
65 0.43
66 0.39
67 0.4
68 0.46
69 0.48
70 0.46
71 0.43
72 0.41
73 0.39
74 0.42
75 0.41
76 0.37
77 0.33
78 0.38
79 0.38
80 0.36
81 0.34
82 0.32
83 0.32
84 0.28
85 0.27
86 0.25
87 0.27
88 0.24
89 0.23
90 0.21
91 0.18
92 0.18
93 0.16
94 0.11
95 0.08
96 0.07
97 0.08
98 0.08
99 0.09
100 0.09
101 0.08
102 0.07
103 0.07
104 0.07
105 0.06
106 0.05
107 0.05
108 0.04
109 0.04
110 0.03
111 0.03
112 0.03
113 0.03
114 0.04
115 0.04
116 0.05
117 0.06
118 0.06
119 0.07
120 0.08
121 0.09
122 0.09
123 0.1
124 0.11
125 0.12
126 0.15
127 0.18
128 0.19
129 0.2
130 0.21
131 0.23
132 0.23
133 0.23
134 0.27
135 0.23
136 0.31
137 0.32
138 0.35
139 0.34
140 0.34
141 0.39
142 0.37
143 0.39
144 0.31
145 0.29
146 0.28
147 0.29
148 0.27
149 0.22
150 0.2
151 0.21
152 0.26
153 0.29
154 0.3
155 0.3
156 0.3
157 0.31
158 0.31
159 0.29
160 0.25
161 0.23
162 0.26
163 0.26
164 0.25
165 0.24
166 0.24
167 0.23
168 0.23
169 0.21
170 0.17
171 0.16
172 0.17
173 0.17
174 0.15
175 0.15
176 0.15
177 0.14
178 0.11
179 0.12
180 0.12
181 0.12
182 0.14
183 0.14
184 0.18
185 0.2
186 0.25
187 0.26
188 0.32
189 0.37
190 0.39
191 0.42
192 0.4
193 0.42
194 0.41
195 0.45
196 0.5
197 0.51
198 0.48
199 0.48
200 0.48
201 0.43
202 0.39
203 0.33
204 0.24
205 0.19
206 0.17
207 0.15
208 0.11
209 0.1
210 0.1
211 0.1
212 0.1
213 0.09
214 0.1
215 0.11
216 0.14
217 0.17
218 0.21
219 0.24
220 0.25
221 0.28
222 0.29
223 0.31
224 0.32
225 0.35
226 0.39
227 0.43
228 0.48
229 0.54
230 0.59
231 0.66
232 0.73
233 0.78
234 0.8
235 0.79
236 0.78
237 0.78
238 0.81
239 0.8
240 0.76
241 0.69
242 0.61
243 0.58
244 0.58
245 0.52