Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177BW09

Protein Details
Accession A0A177BW09    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MECWSRKRDKTKSFLTKWIAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11mito_nucl 11, mito 9, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
IPR038718  SNF2-like_sf  
Gene Ontology GO:0016787  F:hydrolase activity  
Amino Acid Sequences MECWSRKRDKTKSFLTKWIAANKHKKVFKDIRFDPTKPIIECLEQLFNCAHIVIGDELHTIKNPSVNMHTAFRFISAEAHFVLLMTATPTPWSHEDLVGQLNVIYNPQLNDNVSDLTIEECRQLYMDACLLERRALHLTANAYAKAFPSVFKDKVAIGNA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.77
3 0.74
4 0.7
5 0.7
6 0.66
7 0.65
8 0.69
9 0.69
10 0.72
11 0.69
12 0.65
13 0.66
14 0.69
15 0.67
16 0.67
17 0.63
18 0.64
19 0.67
20 0.66
21 0.62
22 0.59
23 0.57
24 0.47
25 0.45
26 0.37
27 0.31
28 0.32
29 0.28
30 0.28
31 0.22
32 0.23
33 0.2
34 0.19
35 0.17
36 0.15
37 0.12
38 0.06
39 0.07
40 0.06
41 0.06
42 0.06
43 0.06
44 0.07
45 0.07
46 0.08
47 0.07
48 0.07
49 0.09
50 0.09
51 0.11
52 0.13
53 0.15
54 0.17
55 0.18
56 0.18
57 0.17
58 0.17
59 0.16
60 0.14
61 0.11
62 0.12
63 0.1
64 0.11
65 0.1
66 0.1
67 0.09
68 0.08
69 0.08
70 0.05
71 0.04
72 0.04
73 0.04
74 0.04
75 0.05
76 0.05
77 0.08
78 0.09
79 0.12
80 0.12
81 0.12
82 0.13
83 0.13
84 0.15
85 0.12
86 0.11
87 0.08
88 0.08
89 0.07
90 0.07
91 0.06
92 0.06
93 0.06
94 0.08
95 0.09
96 0.09
97 0.1
98 0.11
99 0.12
100 0.11
101 0.1
102 0.09
103 0.1
104 0.1
105 0.09
106 0.09
107 0.09
108 0.09
109 0.1
110 0.1
111 0.09
112 0.1
113 0.12
114 0.11
115 0.12
116 0.13
117 0.14
118 0.15
119 0.14
120 0.16
121 0.16
122 0.17
123 0.17
124 0.19
125 0.21
126 0.24
127 0.26
128 0.23
129 0.21
130 0.21
131 0.21
132 0.2
133 0.18
134 0.15
135 0.19
136 0.26
137 0.27
138 0.28
139 0.29
140 0.28