Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177C1C6

Protein Details
Accession A0A177C1C6   
Localization Confidence Medium
Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
160-188EWQRRDKYLRTQRRRKEGKLLRQRFKLRTBasic
207-232WKNWEPDKERSRQRPQQQQQQPPEPTHydrophilic
NLS Segment(s)
PositionSequence
169-201RTQRRRKEGKLLRQRFKLRTLKKTWKVELKRFG
Subcellular Location(s) nucl 11, cyto_nucl 10.833, mito_nucl 10.499, mito 8.5, cyto 7.5
Family & Domain DBs
Amino Acid Sequences MHRPMEPSPLRHSKDFLSPHGSTRTLGSVTSRRSQRSASTRHYGSHLSTIPSRSNISVFSPPFSPPLNPALHTRPLRLSSLHVLPHHPYPHGHYHQHSHITVGTVHSVQHYPRGPFKSGCPACGVDPVVLFPRHPWDQKHRQPWWEHLKEEYDFVKPYIEWQRRDKYLRTQRRRKEGKLLRQRFKLRTLKKTWKVELKRFGWKLLGWKNWEPDKERSRQRPQQQQQQPPEPTFNLLVTGGEDSNATQDDRDIQGHEARQELLGESEARTDGERADTSDAGNCLRGLAGKHESKSTSKC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.52
3 0.48
4 0.46
5 0.43
6 0.45
7 0.48
8 0.45
9 0.37
10 0.34
11 0.33
12 0.25
13 0.24
14 0.26
15 0.27
16 0.31
17 0.39
18 0.42
19 0.42
20 0.44
21 0.46
22 0.49
23 0.52
24 0.55
25 0.55
26 0.58
27 0.56
28 0.55
29 0.56
30 0.49
31 0.42
32 0.41
33 0.36
34 0.31
35 0.32
36 0.33
37 0.32
38 0.32
39 0.32
40 0.26
41 0.24
42 0.23
43 0.23
44 0.27
45 0.26
46 0.25
47 0.25
48 0.25
49 0.26
50 0.26
51 0.23
52 0.18
53 0.24
54 0.24
55 0.24
56 0.28
57 0.3
58 0.37
59 0.38
60 0.37
61 0.36
62 0.36
63 0.36
64 0.33
65 0.31
66 0.28
67 0.31
68 0.32
69 0.29
70 0.29
71 0.29
72 0.34
73 0.32
74 0.28
75 0.24
76 0.25
77 0.34
78 0.37
79 0.39
80 0.36
81 0.4
82 0.43
83 0.48
84 0.42
85 0.34
86 0.29
87 0.27
88 0.24
89 0.2
90 0.17
91 0.12
92 0.12
93 0.12
94 0.12
95 0.11
96 0.16
97 0.19
98 0.19
99 0.26
100 0.29
101 0.31
102 0.3
103 0.33
104 0.38
105 0.35
106 0.34
107 0.3
108 0.27
109 0.25
110 0.27
111 0.25
112 0.15
113 0.14
114 0.14
115 0.14
116 0.13
117 0.13
118 0.1
119 0.15
120 0.18
121 0.2
122 0.23
123 0.29
124 0.4
125 0.48
126 0.57
127 0.56
128 0.59
129 0.59
130 0.64
131 0.65
132 0.58
133 0.51
134 0.43
135 0.42
136 0.36
137 0.36
138 0.28
139 0.19
140 0.16
141 0.15
142 0.14
143 0.11
144 0.16
145 0.23
146 0.28
147 0.3
148 0.36
149 0.41
150 0.46
151 0.5
152 0.48
153 0.49
154 0.54
155 0.62
156 0.66
157 0.7
158 0.72
159 0.8
160 0.84
161 0.77
162 0.77
163 0.76
164 0.76
165 0.77
166 0.8
167 0.76
168 0.77
169 0.81
170 0.73
171 0.74
172 0.73
173 0.69
174 0.69
175 0.71
176 0.73
177 0.74
178 0.79
179 0.75
180 0.76
181 0.76
182 0.75
183 0.75
184 0.69
185 0.7
186 0.63
187 0.58
188 0.51
189 0.44
190 0.44
191 0.43
192 0.44
193 0.4
194 0.42
195 0.47
196 0.5
197 0.52
198 0.48
199 0.49
200 0.51
201 0.54
202 0.59
203 0.63
204 0.68
205 0.73
206 0.78
207 0.8
208 0.82
209 0.84
210 0.85
211 0.85
212 0.83
213 0.84
214 0.79
215 0.7
216 0.66
217 0.56
218 0.49
219 0.41
220 0.32
221 0.24
222 0.19
223 0.16
224 0.13
225 0.14
226 0.11
227 0.09
228 0.09
229 0.08
230 0.09
231 0.1
232 0.09
233 0.07
234 0.08
235 0.12
236 0.14
237 0.15
238 0.15
239 0.17
240 0.21
241 0.24
242 0.25
243 0.23
244 0.21
245 0.21
246 0.2
247 0.18
248 0.14
249 0.14
250 0.13
251 0.12
252 0.13
253 0.13
254 0.12
255 0.13
256 0.12
257 0.12
258 0.15
259 0.16
260 0.16
261 0.2
262 0.2
263 0.2
264 0.23
265 0.23
266 0.2
267 0.2
268 0.18
269 0.14
270 0.14
271 0.15
272 0.13
273 0.19
274 0.26
275 0.3
276 0.32
277 0.36
278 0.39