Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A177C0Q0

Protein Details
Accession A0A177C0Q0    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
60-81LCRTRESPVKPPPMRKRTWRPRBasic
NLS Segment(s)
PositionSequence
69-81KPPPMRKRTWRPR
Subcellular Location(s) mito 12, plas 7, nucl 3, cyto 3, cyto_nucl 3
Family & Domain DBs
Amino Acid Sequences MTFRRIPANFMTYNTLVPRCVKDWKDTLFIGFLGSIGKGVFVAARSKVLANTPRNRRSDLCRTRESPVKPPPMRKRTWRPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.28
3 0.24
4 0.25
5 0.26
6 0.22
7 0.29
8 0.29
9 0.31
10 0.36
11 0.38
12 0.4
13 0.36
14 0.34
15 0.27
16 0.25
17 0.2
18 0.14
19 0.11
20 0.07
21 0.06
22 0.05
23 0.04
24 0.04
25 0.03
26 0.04
27 0.04
28 0.04
29 0.06
30 0.06
31 0.07
32 0.08
33 0.08
34 0.09
35 0.13
36 0.2
37 0.26
38 0.35
39 0.44
40 0.5
41 0.53
42 0.56
43 0.55
44 0.56
45 0.59
46 0.61
47 0.58
48 0.58
49 0.59
50 0.6
51 0.65
52 0.62
53 0.6
54 0.59
55 0.63
56 0.62
57 0.7
58 0.76
59 0.77
60 0.8
61 0.81