Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A177BVI6

Protein Details
Accession A0A177BVI6    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
12-36PVPRTLLPTGRRRRRRRLASASGCIHydrophilic
NLS Segment(s)
PositionSequence
21-28GRRRRRRR
Subcellular Location(s) nucl 21, mito 3, cyto 3, cyto_mito 3
Family & Domain DBs
Amino Acid Sequences MFETDHAASKLPVPRTLLPTGRRRRRRRLASASGCIGHHTYYAACRQSLRACTSVRGCSWLAAHLGIVDYRSTASHA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.37
3 0.42
4 0.43
5 0.44
6 0.51
7 0.59
8 0.64
9 0.71
10 0.74
11 0.8
12 0.84
13 0.87
14 0.87
15 0.86
16 0.86
17 0.83
18 0.79
19 0.7
20 0.61
21 0.51
22 0.42
23 0.32
24 0.21
25 0.14
26 0.1
27 0.08
28 0.08
29 0.13
30 0.13
31 0.12
32 0.13
33 0.15
34 0.19
35 0.23
36 0.25
37 0.25
38 0.25
39 0.28
40 0.32
41 0.33
42 0.29
43 0.28
44 0.25
45 0.23
46 0.23
47 0.21
48 0.18
49 0.15
50 0.14
51 0.11
52 0.11
53 0.1
54 0.1
55 0.08
56 0.07
57 0.08