Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177C8F7

Protein Details
Accession A0A177C8F7    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
57-82RSLLPSCPPRRQRYPHPRLHHSRIAVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, mito 9, cyto_nucl 8.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MCKPLAAGYVMALGVEWIQNPTTHPSVVYQHRNPALVMPAAPAYITPAMQPPAPTIRSLLPSCPPRRQRYPHPRLHHSRIAVACL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.06
4 0.06
5 0.06
6 0.07
7 0.09
8 0.14
9 0.15
10 0.15
11 0.15
12 0.16
13 0.22
14 0.29
15 0.36
16 0.33
17 0.37
18 0.39
19 0.39
20 0.36
21 0.31
22 0.26
23 0.18
24 0.16
25 0.11
26 0.09
27 0.09
28 0.08
29 0.07
30 0.06
31 0.06
32 0.06
33 0.06
34 0.07
35 0.08
36 0.09
37 0.1
38 0.1
39 0.14
40 0.15
41 0.15
42 0.15
43 0.17
44 0.21
45 0.22
46 0.22
47 0.25
48 0.33
49 0.38
50 0.46
51 0.52
52 0.55
53 0.63
54 0.69
55 0.73
56 0.76
57 0.81
58 0.82
59 0.83
60 0.85
61 0.85
62 0.86
63 0.82
64 0.74
65 0.72