Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177CXD9

Protein Details
Accession A0A177CXD9    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MRLRTRPACSLRRSRRPRFASTALHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito 12, cyto_nucl 8
Family & Domain DBs
Amino Acid Sequences MRLRTRPACSLRRSRRPRFASTALRLEYSPAKCLLVTNNKSNLKTEMSNPAGRPNSDIDVAASIVFLAGPGGVFYNEQILFPDGASCSRLQSKYIRLMTVHNVMAYLYS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.86
3 0.84
4 0.83
5 0.8
6 0.78
7 0.77
8 0.73
9 0.71
10 0.61
11 0.56
12 0.48
13 0.43
14 0.41
15 0.32
16 0.28
17 0.21
18 0.2
19 0.19
20 0.2
21 0.24
22 0.27
23 0.3
24 0.33
25 0.41
26 0.44
27 0.45
28 0.45
29 0.41
30 0.34
31 0.31
32 0.28
33 0.28
34 0.28
35 0.3
36 0.29
37 0.32
38 0.31
39 0.29
40 0.29
41 0.22
42 0.2
43 0.18
44 0.17
45 0.11
46 0.1
47 0.1
48 0.08
49 0.06
50 0.05
51 0.04
52 0.04
53 0.03
54 0.02
55 0.02
56 0.02
57 0.02
58 0.03
59 0.03
60 0.04
61 0.04
62 0.08
63 0.08
64 0.09
65 0.1
66 0.11
67 0.11
68 0.11
69 0.12
70 0.09
71 0.1
72 0.11
73 0.1
74 0.12
75 0.18
76 0.19
77 0.21
78 0.26
79 0.32
80 0.4
81 0.43
82 0.42
83 0.37
84 0.4
85 0.43
86 0.44
87 0.38
88 0.29
89 0.26