Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A177C8P4

Protein Details
Accession A0A177C8P4    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
17-47SRVPCFDGARKSRRRKRRTTRQRTRQSGTNTHydrophilic
NLS Segment(s)
PositionSequence
26-39RKSRRRKRRTTRQR
Subcellular Location(s) nucl 20, mito 3, cyto 3, cyto_mito 3
Family & Domain DBs
Amino Acid Sequences MHSLAISHNADVSIDLSRVPCFDGARKSRRRKRRTTRQRTRQSGTNTKHLLKCHVAQSRRSWGRGTQLHRLDECAASRVRIWLGGRAARIRLLPLTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.1
4 0.1
5 0.1
6 0.11
7 0.12
8 0.12
9 0.16
10 0.25
11 0.32
12 0.41
13 0.51
14 0.61
15 0.69
16 0.78
17 0.83
18 0.85
19 0.88
20 0.9
21 0.91
22 0.92
23 0.94
24 0.94
25 0.95
26 0.92
27 0.85
28 0.81
29 0.78
30 0.76
31 0.68
32 0.66
33 0.59
34 0.54
35 0.53
36 0.46
37 0.42
38 0.35
39 0.34
40 0.33
41 0.36
42 0.36
43 0.36
44 0.41
45 0.47
46 0.47
47 0.46
48 0.4
49 0.36
50 0.42
51 0.45
52 0.44
53 0.43
54 0.45
55 0.47
56 0.46
57 0.46
58 0.39
59 0.35
60 0.31
61 0.25
62 0.2
63 0.18
64 0.18
65 0.18
66 0.16
67 0.18
68 0.18
69 0.21
70 0.25
71 0.28
72 0.31
73 0.32
74 0.33
75 0.31
76 0.3
77 0.27