Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177CPE3

Protein Details
Accession A0A177CPE3   
Localization Confidence Low
Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
54-73LAKKLFQRRARGKKLPLLVKHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 16, cyto_nucl 12, nucl 6, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR016024  ARM-type_fold  
IPR036249  Thioredoxin-like_sf  
CDD cd00570  GST_N_family  
Amino Acid Sequences MAELAVYDNDPTLYLFTSLTAGSSHIITATSRIETILKANKIPFKGVDTATDELAKKLFQRRARGKKLPLLVKEGFVIADLDQVEEWNEYDELKEALGAPAVPAPAVAVPLAASKTPSAPAASAAVGSAPGKENTPKQTPEQNLAIRQLGAEAASIAAAKKHVPAKISTTNPLLTAKASASSTPTSATTPSKPAVASPSAILSPRSIPLPSTPANVGKAQGEVVSEFHGRRVQSPGAEEIKMVEEQTAIKEVSSSEEEDSEEEDEEDSEEDSEEEEEEDDDEEEEEEETAQPAKIPAKADAKDAANEAPKPDAAAGVKKEAPTQAQPAKAADKAGVSVED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.1
4 0.11
5 0.11
6 0.11
7 0.1
8 0.1
9 0.09
10 0.1
11 0.09
12 0.08
13 0.09
14 0.09
15 0.11
16 0.12
17 0.12
18 0.12
19 0.13
20 0.14
21 0.14
22 0.21
23 0.26
24 0.27
25 0.29
26 0.34
27 0.39
28 0.4
29 0.42
30 0.37
31 0.33
32 0.36
33 0.34
34 0.33
35 0.32
36 0.31
37 0.3
38 0.32
39 0.27
40 0.23
41 0.23
42 0.19
43 0.19
44 0.26
45 0.32
46 0.34
47 0.45
48 0.55
49 0.65
50 0.74
51 0.78
52 0.77
53 0.77
54 0.8
55 0.77
56 0.7
57 0.67
58 0.58
59 0.5
60 0.44
61 0.36
62 0.27
63 0.19
64 0.17
65 0.09
66 0.1
67 0.09
68 0.09
69 0.08
70 0.09
71 0.09
72 0.08
73 0.09
74 0.08
75 0.08
76 0.07
77 0.08
78 0.09
79 0.08
80 0.08
81 0.08
82 0.07
83 0.07
84 0.07
85 0.07
86 0.06
87 0.07
88 0.07
89 0.06
90 0.06
91 0.06
92 0.05
93 0.06
94 0.05
95 0.04
96 0.04
97 0.06
98 0.06
99 0.06
100 0.07
101 0.07
102 0.08
103 0.09
104 0.09
105 0.09
106 0.09
107 0.1
108 0.1
109 0.1
110 0.09
111 0.08
112 0.07
113 0.07
114 0.07
115 0.06
116 0.06
117 0.07
118 0.08
119 0.1
120 0.14
121 0.19
122 0.24
123 0.26
124 0.28
125 0.35
126 0.36
127 0.38
128 0.4
129 0.37
130 0.35
131 0.35
132 0.32
133 0.24
134 0.22
135 0.18
136 0.11
137 0.09
138 0.06
139 0.04
140 0.03
141 0.03
142 0.04
143 0.03
144 0.04
145 0.04
146 0.04
147 0.08
148 0.11
149 0.12
150 0.14
151 0.15
152 0.21
153 0.27
154 0.29
155 0.29
156 0.27
157 0.26
158 0.26
159 0.26
160 0.2
161 0.13
162 0.12
163 0.1
164 0.09
165 0.09
166 0.08
167 0.1
168 0.1
169 0.1
170 0.1
171 0.11
172 0.1
173 0.12
174 0.14
175 0.13
176 0.16
177 0.16
178 0.16
179 0.15
180 0.15
181 0.17
182 0.16
183 0.15
184 0.12
185 0.13
186 0.12
187 0.13
188 0.13
189 0.1
190 0.1
191 0.1
192 0.11
193 0.1
194 0.1
195 0.11
196 0.16
197 0.16
198 0.17
199 0.18
200 0.19
201 0.21
202 0.21
203 0.2
204 0.16
205 0.15
206 0.13
207 0.12
208 0.1
209 0.08
210 0.08
211 0.1
212 0.11
213 0.11
214 0.12
215 0.15
216 0.15
217 0.16
218 0.21
219 0.2
220 0.2
221 0.22
222 0.26
223 0.26
224 0.25
225 0.23
226 0.19
227 0.19
228 0.18
229 0.16
230 0.11
231 0.08
232 0.09
233 0.1
234 0.12
235 0.1
236 0.09
237 0.09
238 0.09
239 0.12
240 0.14
241 0.14
242 0.12
243 0.13
244 0.14
245 0.14
246 0.15
247 0.13
248 0.11
249 0.1
250 0.09
251 0.09
252 0.09
253 0.09
254 0.08
255 0.07
256 0.07
257 0.06
258 0.07
259 0.07
260 0.07
261 0.07
262 0.07
263 0.06
264 0.07
265 0.08
266 0.07
267 0.07
268 0.07
269 0.07
270 0.07
271 0.07
272 0.07
273 0.07
274 0.07
275 0.07
276 0.08
277 0.08
278 0.08
279 0.11
280 0.13
281 0.16
282 0.18
283 0.23
284 0.31
285 0.32
286 0.34
287 0.37
288 0.37
289 0.36
290 0.35
291 0.34
292 0.3
293 0.31
294 0.29
295 0.26
296 0.24
297 0.23
298 0.21
299 0.21
300 0.19
301 0.24
302 0.26
303 0.29
304 0.32
305 0.31
306 0.34
307 0.33
308 0.35
309 0.33
310 0.39
311 0.4
312 0.41
313 0.42
314 0.43
315 0.44
316 0.41
317 0.38
318 0.3
319 0.25
320 0.22