Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177CDP5

Protein Details
Accession A0A177CDP5    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MGKRKSAKKPQGPRKKEKLPTTFQCLHydrophilic
NLS Segment(s)
PositionSequence
3-18KRKSAKKPQGPRKKEK
Subcellular Location(s) nucl 15.5, cyto_nucl 10, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKSAKKPQGPRKKEKLPTTFQCLFCNHENSVSVSIEKKSGVGNLQCKVCGQTFQTNTNYLSAPVDVYSDWVDACDAVAKEAAAANTSTSRPVNRGGRSRVEEETEDFVVQDDADAEGEYDDY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.91
3 0.89
4 0.88
5 0.86
6 0.84
7 0.81
8 0.8
9 0.77
10 0.68
11 0.63
12 0.55
13 0.51
14 0.46
15 0.43
16 0.35
17 0.29
18 0.28
19 0.27
20 0.28
21 0.24
22 0.2
23 0.18
24 0.18
25 0.16
26 0.15
27 0.13
28 0.11
29 0.12
30 0.15
31 0.18
32 0.22
33 0.24
34 0.25
35 0.24
36 0.24
37 0.24
38 0.21
39 0.18
40 0.17
41 0.21
42 0.23
43 0.27
44 0.29
45 0.28
46 0.28
47 0.27
48 0.24
49 0.17
50 0.15
51 0.11
52 0.09
53 0.07
54 0.07
55 0.05
56 0.07
57 0.07
58 0.06
59 0.06
60 0.06
61 0.06
62 0.05
63 0.05
64 0.07
65 0.06
66 0.07
67 0.07
68 0.07
69 0.07
70 0.08
71 0.08
72 0.06
73 0.07
74 0.07
75 0.09
76 0.1
77 0.12
78 0.12
79 0.13
80 0.14
81 0.22
82 0.28
83 0.33
84 0.4
85 0.43
86 0.5
87 0.54
88 0.56
89 0.51
90 0.48
91 0.43
92 0.38
93 0.37
94 0.31
95 0.26
96 0.22
97 0.2
98 0.16
99 0.14
100 0.11
101 0.07
102 0.06
103 0.07
104 0.07
105 0.07