Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177CPN1

Protein Details
Accession A0A177CPN1   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
56-84IAPIRTPPSSRKEKRKQRKNATLPTPPSSHydrophilic
NLS Segment(s)
PositionSequence
64-74SSRKEKRKQRK
Subcellular Location(s) mito_nucl 10.166, nucl 10, mito 10, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR001328  Pept_tRNA_hydro  
IPR018171  Pept_tRNA_hydro_CS  
IPR036416  Pept_tRNA_hydro_sf  
Gene Ontology GO:0004045  F:aminoacyl-tRNA hydrolase activity  
Pfam View protein in Pfam  
PF01195  Pept_tRNA_hydro  
PROSITE View protein in PROSITE  
PS01196  PEPT_TRNA_HYDROL_2  
Amino Acid Sequences MCGNAATRAHVDTPAPAAIPASAPTDRRPKTIDARPPTSCNNHDDDSTTTFSQPEIAPIRTPPSSRKEKRKQRKNATLPTPPSSDTEQPTKRTPPNNPQRAPSLSPSLTMAKSLTQKTYPLLICSLGNPGPTYAHTLHSAGHTLTSHIAAVKSYQPFTAGLSGRVARPDNTTYSFGPLQGFRKTNSKEVGPGEDDWTLWQSTSLMNVSGKPLARAFAAFSSELARHGRGPGRLVVIHDELEAPLGKVSVRDGGSSARGHNGVKSVQGAMPGGTKWWRIGVGIGRPESREPDAVAGYVLRKMHAGEMRAMEKACAGVVKVLREISEGKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.18
3 0.16
4 0.15
5 0.13
6 0.14
7 0.13
8 0.15
9 0.16
10 0.18
11 0.23
12 0.33
13 0.35
14 0.37
15 0.4
16 0.42
17 0.49
18 0.57
19 0.61
20 0.59
21 0.65
22 0.66
23 0.66
24 0.66
25 0.65
26 0.59
27 0.53
28 0.5
29 0.45
30 0.41
31 0.39
32 0.36
33 0.32
34 0.33
35 0.3
36 0.24
37 0.23
38 0.22
39 0.22
40 0.18
41 0.21
42 0.21
43 0.21
44 0.22
45 0.24
46 0.28
47 0.28
48 0.3
49 0.3
50 0.33
51 0.43
52 0.51
53 0.61
54 0.67
55 0.76
56 0.85
57 0.89
58 0.92
59 0.92
60 0.94
61 0.94
62 0.93
63 0.9
64 0.88
65 0.83
66 0.76
67 0.68
68 0.58
69 0.5
70 0.45
71 0.41
72 0.35
73 0.39
74 0.39
75 0.4
76 0.44
77 0.48
78 0.49
79 0.52
80 0.56
81 0.58
82 0.64
83 0.71
84 0.68
85 0.64
86 0.64
87 0.62
88 0.57
89 0.5
90 0.46
91 0.36
92 0.34
93 0.33
94 0.3
95 0.25
96 0.22
97 0.19
98 0.16
99 0.21
100 0.22
101 0.22
102 0.2
103 0.21
104 0.21
105 0.27
106 0.24
107 0.2
108 0.19
109 0.18
110 0.17
111 0.16
112 0.19
113 0.13
114 0.13
115 0.12
116 0.11
117 0.11
118 0.11
119 0.15
120 0.13
121 0.14
122 0.15
123 0.15
124 0.15
125 0.15
126 0.16
127 0.11
128 0.11
129 0.09
130 0.09
131 0.09
132 0.08
133 0.08
134 0.07
135 0.07
136 0.06
137 0.08
138 0.11
139 0.12
140 0.12
141 0.12
142 0.12
143 0.12
144 0.13
145 0.17
146 0.13
147 0.13
148 0.14
149 0.15
150 0.14
151 0.16
152 0.16
153 0.11
154 0.14
155 0.15
156 0.16
157 0.18
158 0.2
159 0.19
160 0.21
161 0.21
162 0.19
163 0.18
164 0.18
165 0.18
166 0.2
167 0.21
168 0.19
169 0.27
170 0.28
171 0.32
172 0.32
173 0.3
174 0.29
175 0.3
176 0.32
177 0.26
178 0.24
179 0.22
180 0.19
181 0.19
182 0.15
183 0.15
184 0.11
185 0.09
186 0.08
187 0.07
188 0.07
189 0.08
190 0.08
191 0.08
192 0.08
193 0.09
194 0.11
195 0.13
196 0.13
197 0.13
198 0.13
199 0.12
200 0.12
201 0.12
202 0.12
203 0.1
204 0.12
205 0.11
206 0.11
207 0.12
208 0.12
209 0.14
210 0.14
211 0.14
212 0.13
213 0.16
214 0.2
215 0.2
216 0.22
217 0.22
218 0.24
219 0.23
220 0.24
221 0.24
222 0.22
223 0.2
224 0.18
225 0.16
226 0.13
227 0.13
228 0.12
229 0.08
230 0.07
231 0.07
232 0.07
233 0.06
234 0.08
235 0.12
236 0.12
237 0.12
238 0.13
239 0.15
240 0.19
241 0.2
242 0.2
243 0.17
244 0.19
245 0.19
246 0.19
247 0.2
248 0.18
249 0.18
250 0.18
251 0.17
252 0.16
253 0.18
254 0.17
255 0.14
256 0.15
257 0.13
258 0.14
259 0.15
260 0.15
261 0.14
262 0.16
263 0.15
264 0.14
265 0.18
266 0.22
267 0.27
268 0.32
269 0.34
270 0.34
271 0.35
272 0.37
273 0.37
274 0.34
275 0.28
276 0.24
277 0.24
278 0.23
279 0.22
280 0.2
281 0.18
282 0.16
283 0.17
284 0.16
285 0.13
286 0.13
287 0.14
288 0.2
289 0.23
290 0.24
291 0.25
292 0.31
293 0.32
294 0.34
295 0.34
296 0.27
297 0.23
298 0.21
299 0.17
300 0.13
301 0.11
302 0.14
303 0.17
304 0.2
305 0.22
306 0.22
307 0.22
308 0.23