Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A177CN17

Protein Details
Accession A0A177CN17    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
41-61PQTHCHHYPKQPKARRTPSTMHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11, mito 11, mito_nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR009799  EthD_dom  
Gene Ontology GO:0016491  F:oxidoreductase activity  
Pfam View protein in Pfam  
PF07110  EthD  
Amino Acid Sequences MVFRVYLLAVKAPGISLEEFKEQWDVHHLNLLKEIAGDAYPQTHCHHYPKQPKARRTPSTMVSDIRSSKTRRHS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.1
4 0.13
5 0.15
6 0.15
7 0.16
8 0.18
9 0.16
10 0.16
11 0.21
12 0.2
13 0.17
14 0.23
15 0.23
16 0.2
17 0.22
18 0.21
19 0.14
20 0.13
21 0.12
22 0.07
23 0.06
24 0.06
25 0.04
26 0.06
27 0.07
28 0.08
29 0.1
30 0.13
31 0.15
32 0.22
33 0.28
34 0.36
35 0.46
36 0.54
37 0.63
38 0.69
39 0.75
40 0.8
41 0.83
42 0.8
43 0.78
44 0.74
45 0.7
46 0.69
47 0.64
48 0.56
49 0.49
50 0.48
51 0.43
52 0.42
53 0.42
54 0.37