Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A177C2X8

Protein Details
Accession A0A177C2X8    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
45-74HPPNPIITKQRKKERNKKFKERKTAAPTINHydrophilic
NLS Segment(s)
PositionSequence
53-67KQRKKERNKKFKERK
Subcellular Location(s) mito 22, nucl 3
Family & Domain DBs
Amino Acid Sequences MTPRLVPPHLFYVRARTVLCILCEVSQHTCLLADPGKTPWYHMLHPPNPIITKQRKKERNKKFKERKTAAPTINHTYIRPSQQAPQFQPTRDKTNPGADPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.36
3 0.29
4 0.31
5 0.31
6 0.31
7 0.24
8 0.21
9 0.18
10 0.19
11 0.19
12 0.18
13 0.16
14 0.15
15 0.13
16 0.12
17 0.12
18 0.14
19 0.14
20 0.12
21 0.12
22 0.14
23 0.16
24 0.15
25 0.17
26 0.2
27 0.21
28 0.22
29 0.27
30 0.34
31 0.35
32 0.38
33 0.37
34 0.33
35 0.3
36 0.3
37 0.31
38 0.32
39 0.38
40 0.43
41 0.52
42 0.59
43 0.69
44 0.78
45 0.82
46 0.84
47 0.86
48 0.89
49 0.91
50 0.91
51 0.91
52 0.86
53 0.85
54 0.83
55 0.81
56 0.75
57 0.7
58 0.66
59 0.61
60 0.61
61 0.52
62 0.44
63 0.4
64 0.4
65 0.38
66 0.37
67 0.32
68 0.34
69 0.39
70 0.48
71 0.47
72 0.52
73 0.51
74 0.51
75 0.58
76 0.56
77 0.58
78 0.53
79 0.54
80 0.5
81 0.55