FuNGI

A0A177CAL7

Protein Details

Accession

A0A177CAL7

Localization Confidence

Medium

Confidence Score

10.8

NoLS Segment(s)

Position	Sequence	Protein Nature
458-491	EEAAERKRMRKGERSSKRKARVSQHRAPDQKKGG	Basic

NLS Segment(s)

Position	Sequence
458-498	EEAAERKRMRKGERSSKRKARVSQHRAPDQKKGGRVGRKGV

Subcellular Location(s)

mito 16, nucl 8.5, cyto_nucl 6

Family & Domain DBs

InterPro	View protein in InterPro IPR004827 bZIP IPR000571 Znf_CCCH
Gene Ontology	GO:0003700 F:DNA-binding transcription factor activity GO:0046872 F:metal ion binding
PROSITE	View protein in PROSITE PS00036 BZIP_BASIC PS50103 ZF_C3H1

Amino Acid Sequences

MRRSTASPSSTRLDPSIRYYIHRTPGNAIVPLIPADQLPFRLKDYPRHLSHRELSAGGWNFVGETSGIAWPLALCYSSRDAALDSRGKEISELSGDVHGGDAGVAKIEAVTHVPGTGETTGRIAADGDAVLLGEDEGEVKQIAFRSSEAMSIPDKVAARASCAASVGRTTTRSPSLTESLAAIYAQEARRVGYTKCSPLAAEEKEHCRHWIKTGACKWTTAKEGCRYKHTMPSVEKLAEIGITGVPRWFGERDPNPKAQGVVPCAEEEGGSRTRVGDASQGKAGGMCGVYTTNSVDEPMLMDMDDASGAEDPEVVAETTSAQGLAAKTAETASGASISSPVQSGVSVDAMRNEASAGHPLPTLPSSGAPPKARLAPTVPDSQVPPLDTSSIPNVAVTHSSLSTPPPNMKTSSPAPATAPRSQSLQPKDPRSTPCSPQTGSPRAVLHTKKDAVSRWKNEEAAERKRMRKGERSSKRKARVSQHRAPDQKKGGRVGRKGVKMEAQGVAVAIQADG

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.36
2	0.39
3	0.42
4	0.39
5	0.41
6	0.46
7	0.49
8	0.54
9	0.55
10	0.5
11	0.47
12	0.52
13	0.51
14	0.46
15	0.39
16	0.32
17	0.29
18	0.27
19	0.23
20	0.16
21	0.12
22	0.13
23	0.14
24	0.17
25	0.19
26	0.2
27	0.23
28	0.3
29	0.33
30	0.41
31	0.48
32	0.53
33	0.56
34	0.63
35	0.63
36	0.63
37	0.66
38	0.63
39	0.57
40	0.48
41	0.42
42	0.42
43	0.41
44	0.33
45	0.27
46	0.2
47	0.18
48	0.17
49	0.16
50	0.08
51	0.06
52	0.07
53	0.08
54	0.09
55	0.08
56	0.08
57	0.07
58	0.08
59	0.08
60	0.07
61	0.06
62	0.1
63	0.14
64	0.14
65	0.15
66	0.14
67	0.15
68	0.17
69	0.24
70	0.26
71	0.23
72	0.26
73	0.27
74	0.26
75	0.25
76	0.23
77	0.19
78	0.16
79	0.15
80	0.13
81	0.13
82	0.13
83	0.13
84	0.12
85	0.09
86	0.07
87	0.06
88	0.06
89	0.05
90	0.05
91	0.05
92	0.04
93	0.04
94	0.05
95	0.05
96	0.06
97	0.07
98	0.07
99	0.07
100	0.07
101	0.07
102	0.1
103	0.11
104	0.1
105	0.09
106	0.1
107	0.11
108	0.1
109	0.1
110	0.08
111	0.07
112	0.07
113	0.07
114	0.06
115	0.05
116	0.05
117	0.05
118	0.04
119	0.04
120	0.03
121	0.03
122	0.03
123	0.03
124	0.04
125	0.04
126	0.04
127	0.06
128	0.08
129	0.09
130	0.09
131	0.1
132	0.12
133	0.12
134	0.14
135	0.13
136	0.14
137	0.14
138	0.14
139	0.14
140	0.15
141	0.15
142	0.14
143	0.17
144	0.15
145	0.17
146	0.19
147	0.19
148	0.16
149	0.17
150	0.16
151	0.13
152	0.14
153	0.13
154	0.12
155	0.13
156	0.14
157	0.17
158	0.2
159	0.21
160	0.22
161	0.24
162	0.25
163	0.23
164	0.22
165	0.2
166	0.16
167	0.15
168	0.13
169	0.09
170	0.06
171	0.1
172	0.1
173	0.11
174	0.11
175	0.11
176	0.13
177	0.15
178	0.15
179	0.18
180	0.22
181	0.24
182	0.25
183	0.24
184	0.23
185	0.24
186	0.3
187	0.24
188	0.24
189	0.24
190	0.29
191	0.32
192	0.32
193	0.32
194	0.3
195	0.29
196	0.29
197	0.34
198	0.3
199	0.36
200	0.42
201	0.46
202	0.42
203	0.44
204	0.41
205	0.37
206	0.4
207	0.34
208	0.34
209	0.35
210	0.42
211	0.42
212	0.46
213	0.48
214	0.45
215	0.49
216	0.46
217	0.45
218	0.4
219	0.42
220	0.4
221	0.34
222	0.32
223	0.24
224	0.21
225	0.14
226	0.11
227	0.08
228	0.05
229	0.05
230	0.05
231	0.05
232	0.05
233	0.05
234	0.07
235	0.07
236	0.07
237	0.15
238	0.21
239	0.28
240	0.33
241	0.36
242	0.35
243	0.35
244	0.35
245	0.3
246	0.27
247	0.23
248	0.2
249	0.18
250	0.16
251	0.16
252	0.15
253	0.12
254	0.09
255	0.1
256	0.1
257	0.1
258	0.1
259	0.1
260	0.1
261	0.11
262	0.11
263	0.13
264	0.14
265	0.15
266	0.16
267	0.16
268	0.15
269	0.15
270	0.14
271	0.09
272	0.07
273	0.05
274	0.04
275	0.05
276	0.05
277	0.06
278	0.06
279	0.06
280	0.06
281	0.07
282	0.06
283	0.06
284	0.06
285	0.06
286	0.05
287	0.05
288	0.05
289	0.04
290	0.04
291	0.04
292	0.03
293	0.03
294	0.04
295	0.04
296	0.04
297	0.04
298	0.03
299	0.04
300	0.04
301	0.04
302	0.03
303	0.04
304	0.04
305	0.05
306	0.05
307	0.05
308	0.04
309	0.06
310	0.06
311	0.07
312	0.06
313	0.06
314	0.06
315	0.07
316	0.07
317	0.05
318	0.05
319	0.05
320	0.05
321	0.05
322	0.05
323	0.06
324	0.06
325	0.06
326	0.06
327	0.06
328	0.06
329	0.06
330	0.06
331	0.06
332	0.08
333	0.08
334	0.08
335	0.09
336	0.1
337	0.1
338	0.09
339	0.08
340	0.07
341	0.08
342	0.11
343	0.11
344	0.11
345	0.11
346	0.11
347	0.12
348	0.12
349	0.12
350	0.09
351	0.1
352	0.12
353	0.17
354	0.23
355	0.23
356	0.25
357	0.27
358	0.32
359	0.32
360	0.31
361	0.3
362	0.28
363	0.31
364	0.35
365	0.33
366	0.29
367	0.29
368	0.29
369	0.28
370	0.24
371	0.21
372	0.16
373	0.17
374	0.16
375	0.17
376	0.18
377	0.17
378	0.16
379	0.15
380	0.15
381	0.13
382	0.14
383	0.13
384	0.12
385	0.1
386	0.11
387	0.12
388	0.15
389	0.18
390	0.2
391	0.24
392	0.26
393	0.28
394	0.3
395	0.31
396	0.33
397	0.33
398	0.38
399	0.34
400	0.32
401	0.33
402	0.37
403	0.42
404	0.42
405	0.42
406	0.35
407	0.37
408	0.4
409	0.45
410	0.45
411	0.49
412	0.51
413	0.56
414	0.61
415	0.63
416	0.66
417	0.65
418	0.64
419	0.61
420	0.61
421	0.6
422	0.55
423	0.55
424	0.58
425	0.57
426	0.53
427	0.51
428	0.45
429	0.41
430	0.48
431	0.44
432	0.41
433	0.43
434	0.44
435	0.43
436	0.46
437	0.5
438	0.53
439	0.59
440	0.61
441	0.6
442	0.62
443	0.61
444	0.59
445	0.61
446	0.59
447	0.58
448	0.6
449	0.6
450	0.61
451	0.67
452	0.72
453	0.7
454	0.71
455	0.73
456	0.74
457	0.78
458	0.8
459	0.84
460	0.87
461	0.89
462	0.88
463	0.86
464	0.86
465	0.86
466	0.87
467	0.85
468	0.85
469	0.85
470	0.86
471	0.82
472	0.81
473	0.8
474	0.77
475	0.74
476	0.73
477	0.72
478	0.71
479	0.73
480	0.73
481	0.72
482	0.73
483	0.7
484	0.66
485	0.64
486	0.58
487	0.56
488	0.48
489	0.4
490	0.32
491	0.29
492	0.24
493	0.18

A0A177CAL7

3D AlphaFold-predicted Structure Viewer