Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177CAL7

Protein Details
Accession A0A177CAL7   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
458-491EEAAERKRMRKGERSSKRKARVSQHRAPDQKKGGBasic
NLS Segment(s)
PositionSequence
458-498EEAAERKRMRKGERSSKRKARVSQHRAPDQKKGGRVGRKGV
Subcellular Location(s) mito 16, nucl 8.5, cyto_nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR000571  Znf_CCCH  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
GO:0046872  F:metal ion binding  
PROSITE View protein in PROSITE  
PS00036  BZIP_BASIC  
PS50103  ZF_C3H1  
Amino Acid Sequences MRRSTASPSSTRLDPSIRYYIHRTPGNAIVPLIPADQLPFRLKDYPRHLSHRELSAGGWNFVGETSGIAWPLALCYSSRDAALDSRGKEISELSGDVHGGDAGVAKIEAVTHVPGTGETTGRIAADGDAVLLGEDEGEVKQIAFRSSEAMSIPDKVAARASCAASVGRTTTRSPSLTESLAAIYAQEARRVGYTKCSPLAAEEKEHCRHWIKTGACKWTTAKEGCRYKHTMPSVEKLAEIGITGVPRWFGERDPNPKAQGVVPCAEEEGGSRTRVGDASQGKAGGMCGVYTTNSVDEPMLMDMDDASGAEDPEVVAETTSAQGLAAKTAETASGASISSPVQSGVSVDAMRNEASAGHPLPTLPSSGAPPKARLAPTVPDSQVPPLDTSSIPNVAVTHSSLSTPPPNMKTSSPAPATAPRSQSLQPKDPRSTPCSPQTGSPRAVLHTKKDAVSRWKNEEAAERKRMRKGERSSKRKARVSQHRAPDQKKGGRVGRKGVKMEAQGVAVAIQADG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.39
3 0.42
4 0.39
5 0.41
6 0.46
7 0.49
8 0.54
9 0.55
10 0.5
11 0.47
12 0.52
13 0.51
14 0.46
15 0.39
16 0.32
17 0.29
18 0.27
19 0.23
20 0.16
21 0.12
22 0.13
23 0.14
24 0.17
25 0.19
26 0.2
27 0.23
28 0.3
29 0.33
30 0.41
31 0.48
32 0.53
33 0.56
34 0.63
35 0.63
36 0.63
37 0.66
38 0.63
39 0.57
40 0.48
41 0.42
42 0.42
43 0.41
44 0.33
45 0.27
46 0.2
47 0.18
48 0.17
49 0.16
50 0.08
51 0.06
52 0.07
53 0.08
54 0.09
55 0.08
56 0.08
57 0.07
58 0.08
59 0.08
60 0.07
61 0.06
62 0.1
63 0.14
64 0.14
65 0.15
66 0.14
67 0.15
68 0.17
69 0.24
70 0.26
71 0.23
72 0.26
73 0.27
74 0.26
75 0.25
76 0.23
77 0.19
78 0.16
79 0.15
80 0.13
81 0.13
82 0.13
83 0.13
84 0.12
85 0.09
86 0.07
87 0.06
88 0.06
89 0.05
90 0.05
91 0.05
92 0.04
93 0.04
94 0.05
95 0.05
96 0.06
97 0.07
98 0.07
99 0.07
100 0.07
101 0.07
102 0.1
103 0.11
104 0.1
105 0.09
106 0.1
107 0.11
108 0.1
109 0.1
110 0.08
111 0.07
112 0.07
113 0.07
114 0.06
115 0.05
116 0.05
117 0.05
118 0.04
119 0.04
120 0.03
121 0.03
122 0.03
123 0.03
124 0.04
125 0.04
126 0.04
127 0.06
128 0.08
129 0.09
130 0.09
131 0.1
132 0.12
133 0.12
134 0.14
135 0.13
136 0.14
137 0.14
138 0.14
139 0.14
140 0.15
141 0.15
142 0.14
143 0.17
144 0.15
145 0.17
146 0.19
147 0.19
148 0.16
149 0.17
150 0.16
151 0.13
152 0.14
153 0.13
154 0.12
155 0.13
156 0.14
157 0.17
158 0.2
159 0.21
160 0.22
161 0.24
162 0.25
163 0.23
164 0.22
165 0.2
166 0.16
167 0.15
168 0.13
169 0.09
170 0.06
171 0.1
172 0.1
173 0.11
174 0.11
175 0.11
176 0.13
177 0.15
178 0.15
179 0.18
180 0.22
181 0.24
182 0.25
183 0.24
184 0.23
185 0.24
186 0.3
187 0.24
188 0.24
189 0.24
190 0.29
191 0.32
192 0.32
193 0.32
194 0.3
195 0.29
196 0.29
197 0.34
198 0.3
199 0.36
200 0.42
201 0.46
202 0.42
203 0.44
204 0.41
205 0.37
206 0.4
207 0.34
208 0.34
209 0.35
210 0.42
211 0.42
212 0.46
213 0.48
214 0.45
215 0.49
216 0.46
217 0.45
218 0.4
219 0.42
220 0.4
221 0.34
222 0.32
223 0.24
224 0.21
225 0.14
226 0.11
227 0.08
228 0.05
229 0.05
230 0.05
231 0.05
232 0.05
233 0.05
234 0.07
235 0.07
236 0.07
237 0.15
238 0.21
239 0.28
240 0.33
241 0.36
242 0.35
243 0.35
244 0.35
245 0.3
246 0.27
247 0.23
248 0.2
249 0.18
250 0.16
251 0.16
252 0.15
253 0.12
254 0.09
255 0.1
256 0.1
257 0.1
258 0.1
259 0.1
260 0.1
261 0.11
262 0.11
263 0.13
264 0.14
265 0.15
266 0.16
267 0.16
268 0.15
269 0.15
270 0.14
271 0.09
272 0.07
273 0.05
274 0.04
275 0.05
276 0.05
277 0.06
278 0.06
279 0.06
280 0.06
281 0.07
282 0.06
283 0.06
284 0.06
285 0.06
286 0.05
287 0.05
288 0.05
289 0.04
290 0.04
291 0.04
292 0.03
293 0.03
294 0.04
295 0.04
296 0.04
297 0.04
298 0.03
299 0.04
300 0.04
301 0.04
302 0.03
303 0.04
304 0.04
305 0.05
306 0.05
307 0.05
308 0.04
309 0.06
310 0.06
311 0.07
312 0.06
313 0.06
314 0.06
315 0.07
316 0.07
317 0.05
318 0.05
319 0.05
320 0.05
321 0.05
322 0.05
323 0.06
324 0.06
325 0.06
326 0.06
327 0.06
328 0.06
329 0.06
330 0.06
331 0.06
332 0.08
333 0.08
334 0.08
335 0.09
336 0.1
337 0.1
338 0.09
339 0.08
340 0.07
341 0.08
342 0.11
343 0.11
344 0.11
345 0.11
346 0.11
347 0.12
348 0.12
349 0.12
350 0.09
351 0.1
352 0.12
353 0.17
354 0.23
355 0.23
356 0.25
357 0.27
358 0.32
359 0.32
360 0.31
361 0.3
362 0.28
363 0.31
364 0.35
365 0.33
366 0.29
367 0.29
368 0.29
369 0.28
370 0.24
371 0.21
372 0.16
373 0.17
374 0.16
375 0.17
376 0.18
377 0.17
378 0.16
379 0.15
380 0.15
381 0.13
382 0.14
383 0.13
384 0.12
385 0.1
386 0.11
387 0.12
388 0.15
389 0.18
390 0.2
391 0.24
392 0.26
393 0.28
394 0.3
395 0.31
396 0.33
397 0.33
398 0.38
399 0.34
400 0.32
401 0.33
402 0.37
403 0.42
404 0.42
405 0.42
406 0.35
407 0.37
408 0.4
409 0.45
410 0.45
411 0.49
412 0.51
413 0.56
414 0.61
415 0.63
416 0.66
417 0.65
418 0.64
419 0.61
420 0.61
421 0.6
422 0.55
423 0.55
424 0.58
425 0.57
426 0.53
427 0.51
428 0.45
429 0.41
430 0.48
431 0.44
432 0.41
433 0.43
434 0.44
435 0.43
436 0.46
437 0.5
438 0.53
439 0.59
440 0.61
441 0.6
442 0.62
443 0.61
444 0.59
445 0.61
446 0.59
447 0.58
448 0.6
449 0.6
450 0.61
451 0.67
452 0.72
453 0.7
454 0.71
455 0.73
456 0.74
457 0.78
458 0.8
459 0.84
460 0.87
461 0.89
462 0.88
463 0.86
464 0.86
465 0.86
466 0.87
467 0.85
468 0.85
469 0.85
470 0.86
471 0.82
472 0.81
473 0.8
474 0.77
475 0.74
476 0.73
477 0.72
478 0.71
479 0.73
480 0.73
481 0.72
482 0.73
483 0.7
484 0.66
485 0.64
486 0.58
487 0.56
488 0.48
489 0.4
490 0.32
491 0.29
492 0.24
493 0.18