Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A168MF31

Protein Details
Accession A0A168MF31    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
43-68WFRLKTDTKIRWNAKRRNWRHTKLNIHydrophilic
NLS Segment(s)
PositionSequence
29-62KLGKAKKQNRPLPHWFRLKTDTKIRWNAKRRNWR
Subcellular Location(s) mito 22, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000077  Ribosomal_L39  
IPR023626  Ribosomal_L39e_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00832  Ribosomal_L39  
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MVRYIDPSAIIITTTACFPSQKSFITKVKLGKAKKQNRPLPHWFRLKTDTKIRWNAKRRNWRHTKLNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.08
4 0.09
5 0.1
6 0.15
7 0.16
8 0.18
9 0.22
10 0.28
11 0.32
12 0.36
13 0.38
14 0.38
15 0.43
16 0.47
17 0.45
18 0.48
19 0.54
20 0.6
21 0.64
22 0.7
23 0.69
24 0.69
25 0.75
26 0.76
27 0.75
28 0.73
29 0.73
30 0.65
31 0.62
32 0.63
33 0.61
34 0.57
35 0.58
36 0.58
37 0.57
38 0.66
39 0.69
40 0.72
41 0.76
42 0.79
43 0.8
44 0.83
45 0.83
46 0.84
47 0.87
48 0.85