Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A162QWP2

Protein Details
Accession A0A162QWP2    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-21PTKRKYRRHAKPDRNAPIKPPBasic
NLS Segment(s)
PositionSequence
4-12RKYRRHAKP
Subcellular Location(s) nucl 14, mito 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
Amino Acid Sequences PTKRKYRRHAKPDRNAPIKPPSAYIMFSNDSRAELKNQNLSFAELAKIVGDQWKNLSHIEKQSYERRAMRAKDEYLAALEQYRQT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.81
3 0.75
4 0.72
5 0.66
6 0.56
7 0.47
8 0.39
9 0.34
10 0.34
11 0.29
12 0.25
13 0.22
14 0.21
15 0.22
16 0.19
17 0.19
18 0.19
19 0.18
20 0.18
21 0.2
22 0.22
23 0.27
24 0.26
25 0.27
26 0.26
27 0.26
28 0.22
29 0.18
30 0.16
31 0.09
32 0.09
33 0.07
34 0.06
35 0.05
36 0.09
37 0.09
38 0.09
39 0.11
40 0.14
41 0.15
42 0.16
43 0.19
44 0.18
45 0.24
46 0.28
47 0.3
48 0.33
49 0.39
50 0.42
51 0.46
52 0.46
53 0.46
54 0.49
55 0.49
56 0.51
57 0.5
58 0.48
59 0.44
60 0.42
61 0.37
62 0.32
63 0.29
64 0.23
65 0.18