Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A168HRS3

Protein Details
Accession A0A168HRS3    Localization Confidence High Confidence Score 20
NoLS Segment(s)
PositionSequenceProtein Nature
167-200IKQQEEEERQKRREKKKQKKDHKKKPVDNDDGEDBasic
NLS Segment(s)
PositionSequence
26-56KAKARESRDRFAEKNDERKKLGLPPLKPKRR
175-192RQKRREKKKQKKDHKKKP
Subcellular Location(s) nucl 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR003604  Matrin/U1-like-C_Znf_C2H2  
IPR040107  Snu23  
IPR022755  Znf_C2H2_jaz  
IPR036236  Znf_C2H2_sf  
Gene Ontology GO:0005681  C:spliceosomal complex  
GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
GO:0000398  P:mRNA splicing, via spliceosome  
Pfam View protein in Pfam  
PF12171  zf-C2H2_jaz  
Amino Acid Sequences MSAYGAGKAKDTDFRRTWNKEEYAAKAKARESRDRFAEKNDERKKLGLPPLKPKRRYDDDDESKEALKAREEKIDIESNVGKVQVVQAADSRKQPGFYCKACDITIKDSVTWVDHLNGRKHLNNVGVSSKVEKADLNSVKERLAMLKRKKENPQNEEYNLDERLAAIKQQEEEERQKRREKKKQKKDHKKKPVDNDDGEDEMAKMMGFSGFGSSKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.51
3 0.56
4 0.59
5 0.59
6 0.59
7 0.57
8 0.58
9 0.58
10 0.56
11 0.56
12 0.52
13 0.48
14 0.49
15 0.49
16 0.5
17 0.54
18 0.52
19 0.54
20 0.6
21 0.63
22 0.6
23 0.6
24 0.64
25 0.6
26 0.64
27 0.65
28 0.62
29 0.57
30 0.58
31 0.54
32 0.51
33 0.55
34 0.51
35 0.49
36 0.55
37 0.64
38 0.71
39 0.74
40 0.71
41 0.71
42 0.71
43 0.72
44 0.69
45 0.69
46 0.69
47 0.69
48 0.68
49 0.6
50 0.52
51 0.47
52 0.41
53 0.3
54 0.25
55 0.24
56 0.23
57 0.27
58 0.27
59 0.27
60 0.29
61 0.33
62 0.28
63 0.27
64 0.26
65 0.21
66 0.2
67 0.19
68 0.15
69 0.1
70 0.1
71 0.09
72 0.08
73 0.08
74 0.1
75 0.13
76 0.15
77 0.17
78 0.19
79 0.17
80 0.18
81 0.19
82 0.23
83 0.26
84 0.25
85 0.29
86 0.27
87 0.29
88 0.28
89 0.3
90 0.25
91 0.23
92 0.26
93 0.22
94 0.2
95 0.18
96 0.18
97 0.16
98 0.15
99 0.12
100 0.09
101 0.12
102 0.16
103 0.18
104 0.22
105 0.24
106 0.25
107 0.25
108 0.27
109 0.27
110 0.25
111 0.24
112 0.22
113 0.2
114 0.19
115 0.2
116 0.18
117 0.15
118 0.14
119 0.13
120 0.13
121 0.2
122 0.23
123 0.26
124 0.26
125 0.27
126 0.26
127 0.27
128 0.25
129 0.21
130 0.25
131 0.31
132 0.36
133 0.45
134 0.52
135 0.58
136 0.67
137 0.72
138 0.75
139 0.72
140 0.72
141 0.7
142 0.65
143 0.61
144 0.55
145 0.48
146 0.39
147 0.32
148 0.23
149 0.16
150 0.16
151 0.13
152 0.12
153 0.1
154 0.12
155 0.13
156 0.16
157 0.19
158 0.23
159 0.32
160 0.39
161 0.46
162 0.5
163 0.59
164 0.66
165 0.73
166 0.79
167 0.81
168 0.84
169 0.87
170 0.92
171 0.95
172 0.96
173 0.97
174 0.97
175 0.97
176 0.97
177 0.95
178 0.95
179 0.95
180 0.92
181 0.85
182 0.79
183 0.73
184 0.63
185 0.54
186 0.43
187 0.32
188 0.23
189 0.19
190 0.13
191 0.07
192 0.06
193 0.06
194 0.05
195 0.06
196 0.1