Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A168IR15

Protein Details
Accession A0A168IR15   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
71-95VYGSRLISERKQKKQQQLFNKEANPHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 13, mito 5, E.R. 3, vacu 3, extr 1, pero 1, golg 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR036259  MFS_trans_sf  
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MIISGMAMVAGNYIKREEHAAISATYSFIGALGIIVVSKVGGVLFDDWMKGAPFLLLGIGHCLIMLMSVIVYGSRLISERKQKKQQQLFNKEANPTYIPN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.14
4 0.14
5 0.15
6 0.17
7 0.18
8 0.17
9 0.18
10 0.18
11 0.14
12 0.12
13 0.1
14 0.07
15 0.06
16 0.05
17 0.04
18 0.03
19 0.03
20 0.03
21 0.03
22 0.02
23 0.02
24 0.02
25 0.02
26 0.02
27 0.02
28 0.02
29 0.03
30 0.04
31 0.05
32 0.05
33 0.05
34 0.05
35 0.06
36 0.06
37 0.05
38 0.05
39 0.04
40 0.04
41 0.04
42 0.04
43 0.03
44 0.03
45 0.05
46 0.05
47 0.05
48 0.05
49 0.05
50 0.05
51 0.04
52 0.04
53 0.03
54 0.02
55 0.02
56 0.02
57 0.02
58 0.03
59 0.03
60 0.03
61 0.04
62 0.05
63 0.08
64 0.15
65 0.26
66 0.35
67 0.45
68 0.55
69 0.63
70 0.73
71 0.81
72 0.84
73 0.84
74 0.85
75 0.83
76 0.81
77 0.77
78 0.71
79 0.62
80 0.57