Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A168MMZ0

Protein Details
Accession A0A168MMZ0   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
12-38ENLFRGGYPKPRNKRFLKRLRLKTILSHydrophilic
NLS Segment(s)
PositionSequence
21-30KPRNKRFLKR
Subcellular Location(s) nucl 15, cyto_nucl 10.833, mito_nucl 10.833, mito 5.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR020428  PFA-DSPs  
IPR029021  Prot-tyrosine_phosphatase-like  
IPR004861  Siw14-like  
IPR020422  TYR_PHOSPHATASE_DUAL_dom  
Gene Ontology GO:0008138  F:protein tyrosine/serine/threonine phosphatase activity  
GO:0006470  P:protein dephosphorylation  
Pfam View protein in Pfam  
PF03162  Y_phosphatase2  
PROSITE View protein in PROSITE  
PS50054  TYR_PHOSPHATASE_DUAL  
Amino Acid Sequences LIPPFRFTMVEENLFRGGYPKPRNKRFLKRLRLKTILSLIPDKLMPEMQEFCEENNINLLHLTVDKMKEDNIPLTYNKTLMALQLMIDPANHPLYIHCLDGADVTGLVIACLRKLQMWSISSALGEFVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.29
3 0.23
4 0.22
5 0.25
6 0.34
7 0.41
8 0.5
9 0.59
10 0.69
11 0.76
12 0.84
13 0.85
14 0.86
15 0.87
16 0.88
17 0.89
18 0.89
19 0.86
20 0.76
21 0.7
22 0.65
23 0.57
24 0.49
25 0.42
26 0.32
27 0.28
28 0.26
29 0.21
30 0.16
31 0.14
32 0.11
33 0.11
34 0.13
35 0.12
36 0.16
37 0.16
38 0.15
39 0.2
40 0.19
41 0.17
42 0.18
43 0.17
44 0.14
45 0.13
46 0.13
47 0.07
48 0.07
49 0.08
50 0.07
51 0.07
52 0.08
53 0.08
54 0.09
55 0.1
56 0.11
57 0.12
58 0.12
59 0.13
60 0.13
61 0.17
62 0.17
63 0.16
64 0.15
65 0.14
66 0.12
67 0.11
68 0.11
69 0.07
70 0.07
71 0.08
72 0.08
73 0.07
74 0.07
75 0.07
76 0.08
77 0.09
78 0.09
79 0.08
80 0.08
81 0.14
82 0.15
83 0.15
84 0.13
85 0.12
86 0.12
87 0.13
88 0.13
89 0.08
90 0.06
91 0.05
92 0.06
93 0.06
94 0.06
95 0.07
96 0.06
97 0.06
98 0.07
99 0.08
100 0.09
101 0.1
102 0.15
103 0.19
104 0.21
105 0.23
106 0.24
107 0.24
108 0.23
109 0.22