Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A168MLM8

Protein Details
Accession A0A168MLM8    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
50-71QTYNWQDKYRPRKPRYFNRVHTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019134  Cactin_C  
Pfam View protein in Pfam  
PF09732  CactinC_cactus  
Amino Acid Sequences MEKRRVVLNSIIIPKQHKQEQDQGAQVVEQVRNKDEDEDLFNIEAELGQQTYNWQDKYRPRKPRYFNRVHTGYEWNKYNQTHYDLDNPPPKVVQGYKFNIFYPDLIDPSKAPTYFIDKDPESPDTVLIRFHAGPPYEDIAFRIVNREWEYSHKKGFRCSFDRGVLSLWFHFKRQFYRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.46
3 0.46
4 0.43
5 0.44
6 0.51
7 0.56
8 0.57
9 0.57
10 0.5
11 0.45
12 0.39
13 0.35
14 0.3
15 0.25
16 0.22
17 0.21
18 0.21
19 0.23
20 0.24
21 0.24
22 0.21
23 0.2
24 0.21
25 0.21
26 0.21
27 0.19
28 0.18
29 0.16
30 0.14
31 0.12
32 0.08
33 0.07
34 0.05
35 0.05
36 0.05
37 0.06
38 0.11
39 0.15
40 0.16
41 0.16
42 0.22
43 0.32
44 0.42
45 0.51
46 0.57
47 0.59
48 0.68
49 0.76
50 0.81
51 0.83
52 0.82
53 0.79
54 0.77
55 0.75
56 0.67
57 0.6
58 0.57
59 0.5
60 0.44
61 0.4
62 0.33
63 0.33
64 0.32
65 0.31
66 0.26
67 0.27
68 0.24
69 0.23
70 0.29
71 0.27
72 0.32
73 0.35
74 0.33
75 0.29
76 0.27
77 0.25
78 0.2
79 0.2
80 0.19
81 0.21
82 0.24
83 0.27
84 0.28
85 0.28
86 0.28
87 0.26
88 0.22
89 0.17
90 0.14
91 0.13
92 0.12
93 0.13
94 0.11
95 0.14
96 0.17
97 0.14
98 0.14
99 0.14
100 0.21
101 0.23
102 0.25
103 0.26
104 0.24
105 0.27
106 0.29
107 0.29
108 0.24
109 0.22
110 0.22
111 0.18
112 0.18
113 0.16
114 0.14
115 0.15
116 0.14
117 0.15
118 0.17
119 0.16
120 0.17
121 0.2
122 0.22
123 0.19
124 0.19
125 0.19
126 0.17
127 0.17
128 0.16
129 0.17
130 0.15
131 0.2
132 0.23
133 0.24
134 0.23
135 0.3
136 0.38
137 0.39
138 0.47
139 0.47
140 0.46
141 0.54
142 0.6
143 0.6
144 0.58
145 0.6
146 0.58
147 0.59
148 0.59
149 0.51
150 0.46
151 0.4
152 0.37
153 0.33
154 0.33
155 0.29
156 0.29
157 0.33
158 0.36