Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A168KA22

Protein Details
Accession A0A168KA22   
Localization Confidence Medium
Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
196-223DAETAAEKKRRRQKRRRRLMEKAMTDREBasic
NLS Segment(s)
PositionSequence
203-214KKRRRQKRRRRL
Subcellular Location(s) nucl 17.5, mito_nucl 11.5, mito 4.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004130  Gpn  
IPR030228  Gpn3  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0005525  F:GTP binding  
GO:0016787  F:hydrolase activity  
Pfam View protein in Pfam  
PF03029  ATP_bind_1  
CDD cd17872  GPN3  
Amino Acid Sequences MGRHCQLVMGPAGSGKSTYCATMMTHCQTAGRKVHLVNLDPAAENFEYEPTIDIRELITLEDVMEELDYGPNGGLIYCLEFLMNNVDWLEEEIGTFDDDYLIIDCPGQIELYTHFPIMRRLCETLGRLNMSVCGVYCLESQFIEDKSKYFSGVLSAMSAMVNLEIPHINVMTKMDLIEGDYGNKPIDEEEDDDEDDAETAAEKKRRRQKRRRRLMEKAMTDREMDRYLEPDPMLMAEEADTVLNGEEPSARSLKFQALNQAIVQLIDDYSMVRFIPLNITDEDSVEYVLSHVDNSMQYGEDLEPKEPDDVPEYE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.11
3 0.11
4 0.12
5 0.12
6 0.11
7 0.12
8 0.13
9 0.18
10 0.25
11 0.26
12 0.27
13 0.26
14 0.29
15 0.31
16 0.37
17 0.37
18 0.35
19 0.35
20 0.34
21 0.41
22 0.42
23 0.42
24 0.39
25 0.36
26 0.33
27 0.29
28 0.28
29 0.26
30 0.21
31 0.19
32 0.15
33 0.13
34 0.12
35 0.11
36 0.13
37 0.09
38 0.11
39 0.11
40 0.11
41 0.1
42 0.11
43 0.11
44 0.1
45 0.1
46 0.08
47 0.08
48 0.07
49 0.07
50 0.06
51 0.05
52 0.05
53 0.05
54 0.05
55 0.05
56 0.05
57 0.05
58 0.05
59 0.05
60 0.05
61 0.05
62 0.05
63 0.07
64 0.07
65 0.07
66 0.06
67 0.06
68 0.07
69 0.11
70 0.11
71 0.1
72 0.09
73 0.09
74 0.1
75 0.11
76 0.12
77 0.07
78 0.07
79 0.07
80 0.07
81 0.07
82 0.07
83 0.06
84 0.05
85 0.05
86 0.05
87 0.06
88 0.06
89 0.06
90 0.06
91 0.05
92 0.06
93 0.06
94 0.06
95 0.05
96 0.05
97 0.07
98 0.12
99 0.13
100 0.12
101 0.13
102 0.13
103 0.2
104 0.21
105 0.22
106 0.2
107 0.2
108 0.22
109 0.24
110 0.26
111 0.25
112 0.26
113 0.25
114 0.22
115 0.21
116 0.2
117 0.17
118 0.15
119 0.1
120 0.08
121 0.07
122 0.08
123 0.08
124 0.08
125 0.08
126 0.08
127 0.09
128 0.09
129 0.1
130 0.12
131 0.12
132 0.12
133 0.15
134 0.15
135 0.15
136 0.13
137 0.12
138 0.1
139 0.11
140 0.11
141 0.08
142 0.07
143 0.07
144 0.07
145 0.06
146 0.04
147 0.04
148 0.04
149 0.03
150 0.04
151 0.04
152 0.04
153 0.05
154 0.05
155 0.05
156 0.05
157 0.06
158 0.06
159 0.06
160 0.06
161 0.05
162 0.05
163 0.06
164 0.07
165 0.07
166 0.08
167 0.09
168 0.09
169 0.09
170 0.09
171 0.08
172 0.07
173 0.09
174 0.08
175 0.1
176 0.11
177 0.13
178 0.14
179 0.14
180 0.13
181 0.12
182 0.1
183 0.08
184 0.05
185 0.04
186 0.05
187 0.09
188 0.14
189 0.17
190 0.25
191 0.35
192 0.46
193 0.57
194 0.67
195 0.75
196 0.82
197 0.91
198 0.94
199 0.94
200 0.93
201 0.93
202 0.91
203 0.88
204 0.85
205 0.78
206 0.68
207 0.59
208 0.5
209 0.43
210 0.35
211 0.28
212 0.2
213 0.18
214 0.17
215 0.19
216 0.17
217 0.14
218 0.12
219 0.11
220 0.11
221 0.09
222 0.08
223 0.06
224 0.06
225 0.07
226 0.06
227 0.06
228 0.05
229 0.05
230 0.05
231 0.05
232 0.05
233 0.07
234 0.08
235 0.11
236 0.13
237 0.13
238 0.13
239 0.16
240 0.22
241 0.24
242 0.25
243 0.32
244 0.32
245 0.34
246 0.33
247 0.32
248 0.26
249 0.22
250 0.2
251 0.12
252 0.08
253 0.07
254 0.07
255 0.06
256 0.06
257 0.07
258 0.07
259 0.07
260 0.07
261 0.08
262 0.14
263 0.14
264 0.17
265 0.17
266 0.21
267 0.21
268 0.21
269 0.22
270 0.16
271 0.15
272 0.12
273 0.11
274 0.08
275 0.09
276 0.08
277 0.07
278 0.06
279 0.08
280 0.09
281 0.11
282 0.11
283 0.11
284 0.11
285 0.13
286 0.14
287 0.18
288 0.2
289 0.19
290 0.2
291 0.21
292 0.23
293 0.22
294 0.23