Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A168LT83

Protein Details
Accession A0A168LT83    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-24RDPRGRKKKRHKHPFAPKHPMSAYBasic
NLS Segment(s)
PositionSequence
3-18PRGRKKKRHKHPFAPK
Subcellular Location(s) mito 19, mito_nucl 14.333, nucl 7.5, cyto_nucl 4.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
Amino Acid Sequences RDPRGRKKKRHKHPFAPKHPMSAYLYYLASVYPQVSLNFPGSTVGPISKSISKTWHAMSPEERLPWKQKADSDKARYAREMQVYMA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.96
2 0.95
3 0.95
4 0.85
5 0.8
6 0.7
7 0.63
8 0.56
9 0.47
10 0.38
11 0.3
12 0.28
13 0.21
14 0.2
15 0.15
16 0.11
17 0.09
18 0.07
19 0.06
20 0.07
21 0.08
22 0.09
23 0.1
24 0.11
25 0.11
26 0.11
27 0.1
28 0.09
29 0.09
30 0.08
31 0.07
32 0.06
33 0.07
34 0.1
35 0.12
36 0.14
37 0.15
38 0.18
39 0.2
40 0.22
41 0.22
42 0.25
43 0.23
44 0.25
45 0.26
46 0.28
47 0.28
48 0.29
49 0.29
50 0.29
51 0.33
52 0.36
53 0.38
54 0.37
55 0.39
56 0.45
57 0.53
58 0.59
59 0.61
60 0.63
61 0.64
62 0.64
63 0.61
64 0.57
65 0.55
66 0.51