Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J5JRK7

Protein Details
Accession J5JRK7   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
2-23AAPLIKSLRKVRLRRHCLPLPAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 27
Family & Domain DBs
InterPro View protein in InterPro  
IPR018790  DUF2358  
IPR031342  Mug163-like  
Pfam View protein in Pfam  
PF17119  MMU163  
Amino Acid Sequences MAAPLIKSLRKVRLRRHCLPLPASPPTSRPRCIASYSQAKAQVQSISHAAAAAVAAGPDSTPPPFSLPPSAPPRVVVAHAAPAQRPGQLSPTYFEATGQTWMPLGGGQEPVDPNKAKLGKTLRILQDRMPTLLQSPLPQHILAPNISLQLFPSTHPHLPVVSGRVAYTAALWTSPIAWNRVPLVGNVRIEILAERMTSEPLTFLPRRPGAIADQLVVRWRETTREAAAQGGGAGAAIARSLRLVGGSDPDKAFTGLFIFDFDQEGRVLTHTIETAQEGGNWERGMGAKFVGLTDWLLGGIQRDPGGTPQIPMFERRRRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.81
3 0.83
4 0.8
5 0.79
6 0.76
7 0.73
8 0.68
9 0.66
10 0.61
11 0.54
12 0.52
13 0.53
14 0.54
15 0.49
16 0.45
17 0.44
18 0.43
19 0.47
20 0.48
21 0.47
22 0.51
23 0.5
24 0.53
25 0.53
26 0.5
27 0.46
28 0.43
29 0.38
30 0.29
31 0.29
32 0.25
33 0.2
34 0.19
35 0.18
36 0.14
37 0.1
38 0.09
39 0.07
40 0.05
41 0.04
42 0.04
43 0.04
44 0.04
45 0.04
46 0.06
47 0.06
48 0.07
49 0.09
50 0.13
51 0.14
52 0.17
53 0.22
54 0.23
55 0.3
56 0.37
57 0.39
58 0.35
59 0.34
60 0.35
61 0.3
62 0.29
63 0.24
64 0.18
65 0.2
66 0.23
67 0.23
68 0.21
69 0.22
70 0.22
71 0.21
72 0.21
73 0.17
74 0.18
75 0.2
76 0.21
77 0.2
78 0.23
79 0.23
80 0.22
81 0.21
82 0.18
83 0.16
84 0.17
85 0.15
86 0.11
87 0.1
88 0.1
89 0.09
90 0.08
91 0.08
92 0.07
93 0.08
94 0.08
95 0.1
96 0.11
97 0.12
98 0.16
99 0.15
100 0.14
101 0.2
102 0.23
103 0.21
104 0.26
105 0.31
106 0.33
107 0.36
108 0.43
109 0.43
110 0.45
111 0.46
112 0.43
113 0.43
114 0.39
115 0.37
116 0.3
117 0.24
118 0.2
119 0.21
120 0.18
121 0.14
122 0.14
123 0.15
124 0.16
125 0.15
126 0.14
127 0.13
128 0.15
129 0.13
130 0.12
131 0.1
132 0.1
133 0.1
134 0.1
135 0.09
136 0.09
137 0.09
138 0.09
139 0.12
140 0.15
141 0.16
142 0.17
143 0.17
144 0.14
145 0.15
146 0.16
147 0.14
148 0.12
149 0.11
150 0.1
151 0.1
152 0.1
153 0.09
154 0.08
155 0.06
156 0.05
157 0.05
158 0.05
159 0.04
160 0.05
161 0.08
162 0.09
163 0.11
164 0.11
165 0.12
166 0.13
167 0.15
168 0.15
169 0.13
170 0.17
171 0.18
172 0.18
173 0.17
174 0.17
175 0.14
176 0.14
177 0.14
178 0.1
179 0.07
180 0.06
181 0.07
182 0.07
183 0.08
184 0.08
185 0.08
186 0.07
187 0.07
188 0.14
189 0.14
190 0.15
191 0.21
192 0.22
193 0.23
194 0.24
195 0.24
196 0.21
197 0.26
198 0.25
199 0.19
200 0.19
201 0.18
202 0.21
203 0.2
204 0.17
205 0.13
206 0.12
207 0.15
208 0.17
209 0.2
210 0.2
211 0.22
212 0.22
213 0.22
214 0.21
215 0.18
216 0.15
217 0.11
218 0.08
219 0.05
220 0.04
221 0.03
222 0.02
223 0.03
224 0.02
225 0.02
226 0.03
227 0.03
228 0.03
229 0.04
230 0.05
231 0.06
232 0.11
233 0.13
234 0.16
235 0.16
236 0.17
237 0.18
238 0.17
239 0.17
240 0.12
241 0.12
242 0.09
243 0.09
244 0.1
245 0.1
246 0.1
247 0.12
248 0.11
249 0.11
250 0.1
251 0.11
252 0.1
253 0.1
254 0.1
255 0.09
256 0.1
257 0.1
258 0.1
259 0.1
260 0.11
261 0.11
262 0.11
263 0.12
264 0.14
265 0.15
266 0.18
267 0.17
268 0.16
269 0.15
270 0.17
271 0.17
272 0.15
273 0.13
274 0.11
275 0.11
276 0.12
277 0.11
278 0.1
279 0.09
280 0.09
281 0.08
282 0.07
283 0.07
284 0.07
285 0.08
286 0.09
287 0.1
288 0.1
289 0.11
290 0.12
291 0.14
292 0.2
293 0.19
294 0.2
295 0.2
296 0.25
297 0.26
298 0.32
299 0.38