Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A162RUX9

Protein Details
Accession A0A162RUX9    Localization Confidence High Confidence Score 21.4
NoLS Segment(s)
PositionSequenceProtein Nature
28-49PPPPPAATRKRGRPPTKKAAADHydrophilic
86-106DEPVVKRKRGRPAKLNSDGTKBasic
112-131KADPAAPKRGRGRPRKVVAEBasic
NLS Segment(s)
PositionSequence
31-64PPAATRKRGRPPTKKAAADAAETDAAKKAPKKGN
91-128KRKRGRPAKLNSDGTKKTAAKKADPAAPKRGRGRPRKV
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
IPR000637  HMGI/Y_DNA-bd_CS  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF02178  AT_hook  
PROSITE View protein in PROSITE  
PS00354  HMGI_Y  
Amino Acid Sequences MPRTRKTTTASVKKSDTAASASTEHNAPPPPPAATRKRGRPPTKKAAADAAETDAAKKAPKKGNKEEEEESVKELDVSEQKQGDDDEPVVKRKRGRPAKLNSDGTKKTAAKKADPAAPKRGRGRPRKVVAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.49
3 0.4
4 0.32
5 0.27
6 0.24
7 0.23
8 0.21
9 0.21
10 0.2
11 0.18
12 0.18
13 0.19
14 0.16
15 0.16
16 0.18
17 0.18
18 0.22
19 0.29
20 0.33
21 0.39
22 0.47
23 0.54
24 0.62
25 0.7
26 0.76
27 0.79
28 0.81
29 0.83
30 0.84
31 0.76
32 0.68
33 0.65
34 0.56
35 0.48
36 0.39
37 0.3
38 0.23
39 0.21
40 0.19
41 0.13
42 0.11
43 0.12
44 0.13
45 0.18
46 0.24
47 0.31
48 0.38
49 0.47
50 0.56
51 0.58
52 0.62
53 0.56
54 0.54
55 0.51
56 0.44
57 0.36
58 0.26
59 0.22
60 0.17
61 0.14
62 0.12
63 0.11
64 0.11
65 0.13
66 0.14
67 0.14
68 0.14
69 0.15
70 0.14
71 0.12
72 0.12
73 0.14
74 0.15
75 0.21
76 0.24
77 0.26
78 0.31
79 0.36
80 0.46
81 0.52
82 0.58
83 0.63
84 0.7
85 0.77
86 0.8
87 0.82
88 0.76
89 0.74
90 0.68
91 0.61
92 0.59
93 0.52
94 0.49
95 0.48
96 0.48
97 0.44
98 0.5
99 0.54
100 0.53
101 0.58
102 0.56
103 0.6
104 0.62
105 0.65
106 0.65
107 0.68
108 0.71
109 0.73
110 0.79
111 0.79