Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A162MQN6

Protein Details
Accession A0A162MQN6   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
85-105SIYYQHKREQEQKQQQQQQQEHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 9.5, cyto_nucl 8.5, mito 8, nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007667  Hypoxia_induced_domain  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF04588  HIG_1_N  
PROSITE View protein in PROSITE  
PS51503  HIG1  
Amino Acid Sequences MSNNSYTKEDIERMRIAMEGETALDRIKRKAKEEPLVPAGVALTTFALVAATVGVKTGNRAYANNMFRLRVAAQGFTVLAMVGGSIYYQHKREQEQKQQQQQQQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.28
3 0.24
4 0.19
5 0.16
6 0.11
7 0.1
8 0.09
9 0.09
10 0.09
11 0.11
12 0.12
13 0.17
14 0.24
15 0.26
16 0.3
17 0.39
18 0.47
19 0.52
20 0.53
21 0.55
22 0.51
23 0.48
24 0.43
25 0.34
26 0.25
27 0.17
28 0.14
29 0.07
30 0.04
31 0.03
32 0.03
33 0.03
34 0.03
35 0.03
36 0.03
37 0.03
38 0.03
39 0.02
40 0.03
41 0.03
42 0.03
43 0.04
44 0.05
45 0.08
46 0.09
47 0.1
48 0.15
49 0.23
50 0.25
51 0.29
52 0.29
53 0.26
54 0.26
55 0.28
56 0.24
57 0.21
58 0.2
59 0.15
60 0.14
61 0.15
62 0.15
63 0.12
64 0.11
65 0.06
66 0.05
67 0.04
68 0.04
69 0.03
70 0.03
71 0.03
72 0.04
73 0.08
74 0.11
75 0.13
76 0.19
77 0.23
78 0.3
79 0.4
80 0.49
81 0.57
82 0.65
83 0.74
84 0.8
85 0.85